KEGG   Listeria innocua (serotype 6a): glpDHelp
Entry
glpD              CDS       T00067                                 

Definition
(GenBank) similar to glycerol 3 phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
lin  Listeria innocua (serotype 6a)
Pathway
lin00564  Glycerophospholipid metabolism
lin01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lin00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    glpD
Enzymes [BR:lin01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     glpD
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 Pyr_redox_2 NAD_binding_8 FAD_oxidored FAD_binding_3 Pyr_redox 3HCDH_N Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: CAC96562
Pasteur: LIN01331
UniProt: Q92C60
LinkDB All DBs
Position
1328237..1329913
Genome map
AA seq 558 aa AA seqDB search
MVQLFSAFDRETIERNLQEEKFDLVIVGGGITGAGIALDATSRGMSVALVEMGDFASGTS
SRSTKLVHGGLRYLQQFEIKEVADLGKERAIVYENGPHVTTPEWMMLPFHKGGNMGKTTA
SFGIRLYDYLAGVKKNERRKILSAKETLAKNPFVKKDGLKGSGYYVEYRTDDARLTIEVM
KKAVELGANAINYTKAEHFLYDDKKQVVGVTVTDRLTGKAYDIKGHRVINAAGPWVDKVR
KLDYATNNKHLRLTKGIHLVIDKQKFPMEQAVYFDTPDGRMVFAIPRDKKVYVGTTDTVY
DEAVINPKALESDHNYVIKAINYMFPDVHISEKDIESSWAGVRPLIYEEGKDPSEISRKD
EVWFSESGLITMAGGKLTGYRKMAEKLLDGVSKTLSKETGKKYKPVQTKHLPISGGDIGG
SEQLEAFLSKKAKEGNNRFGWTLEEGREIAKRFGSNIDQLFTYAQEHKDQNETTLPNSLY
AELRYSIQHEAVTTPIDFLLRRTGYLLFDMPYLLEWKDAVVDEMAKQFHWSDDVKQTYIE
ELNIQINDAREPADWHDR
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggtacaattattctcagcttttgatagagaaaccattgaaagaaatttacaagaagaa
aaattcgatttagtcattgttggcggcggtattactggagcaggaatcgcattagatgca
acttccagaggtatgagtgtggcgctagtagaaatgggtgacttcgcaagcggaacttca
agtcgctccacgaaattagtccacggtggcttacgttacctacaacaatttgaaattaaa
gaagtagcagaccttgggaaagaacgcgctatcgtttatgaaaatggtccacacgttacg
actccagaatggatgatgttgccattccataaaggcggaaatatgggtaaaacaacagct
tcctttggtattcgtttatatgactatttagcaggcgtaaagaaaaatgaacgccgcaag
atcttaagcgccaaagaaaccttagcaaaaaacccatttgttaaaaaagatggcttaaaa
ggctctggttactatgtagaataccggaccgatgatgccagattaacgattgaagtaatg
aaaaaagccgttgaacttggcgcaaacgcaattaattatacaaaagcagaacacttctta
tatgatgataaaaaacaagtggttggcgtgactgtaacagaccgtctaactggcaaagct
tacgatattaaaggacatcgcgtaattaatgcagctggaccatgggtagataaagtcaga
aaactcgactatgctacaaataataaacatcttcgcttaacaaaaggtattcatttagtt
atcgataaacaaaaattcccaatggaacaagcggtttatttcgatacaccagatggtcga
atggtttttgctatccctcgtgataaaaaagtgtatgttggtacaacggatacagtttat
gatgaagcagtaattaatccaaaagcactcgaatctgaccataattatgttattaaagcg
atcaactatatgttcccagatgtgcatattagcgaaaaagacattgaatcaagctgggct
ggcgtgcgtccgcttatttacgaagaaggaaaagatccttctgaaatttctcgaaaagat
gaagtttggttctctgaaagtggcttaatcacaatggctggtggtaaattaacaggctac
cgcaaaatggctgaaaaattactagacggtgtatccaaaacattgtccaaagaaactggt
aaaaaatataaaccagttcaaacaaaacatttacctatctcaggtggagacattggcggt
tcagaacaattagaagcattcctttcgaaaaaagcgaaagaaggaaataatcgtttcggt
tggacactagaagaaggtcgcgaaattgctaaacgatttggtagtaatattgatcaattg
tttacctacgcgcaagaacacaaagaccaaaatgaaactactctaccaaatagtctttat
gcagaacttcgctattcgattcaacatgaagccgtaacaacaccgattgatttcttatta
cgccgtacaggttacttgctgtttgatatgccatatttacttgaatggaaagatgcggtt
gtagatgaaatggccaaacaattccactggagcgacgatgtaaaacaaacttatatagaa
gaattaaatatccaaattaatgatgccagagaaccagcagattggcatgatagataa

DBGET integrated database retrieval system