KEGG   Listeria innocua (serotype 6a): lin0070Help
Entry
lin0070           CDS       T00067                                 

Definition
(GenBank) similar to phosphoglycerate dehydrogenase
Organism
lin  Listeria innocua (serotype 6a)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh F420_oxidored AdoHcyase_NAD IlvN NAD_binding_2 NAD_binding_7 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: CAC95303
Pasteur: LIN00070
UniProt: Q92FN4
LinkDB All DBs
Position
74988..75944
Genome map
AA seq 318 aa AA seqDB search
MTASVFVAGKLLPETMEALDKWDVKTYKGKENITESELIKNVTDVEAIICPLSSPITAKV
LESAKNLKIVANIGAGFDNIDVKKAQELGIAVTNTPDVSTEATAELTLGLILDVARRISA
GDRLCRETPEQFKGWAPTFFLGTELSGKTLGIIGLGRIGQAVAKRAAAFGMKIIYSGHHP
KEAAKQWDAEFVSQDELLKRSDVVTIHAAYSPSLKHLLNETTLNTMKSSAFLINAARGPV
VEESALINALEKGVIAGAALDVFEFEPKIGAELGKLENVVLTPHIGNATVETRTEMGRMA
ISNVEAVLAGKQPLHSVY
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgacagcaagcgtatttgtagcaggaaaattactaccagaaacgatggaagctctagat
aaatgggatgtaaaaacgtacaaaggcaaagaaaatattacggagtctgagctaataaaa
aacgttacggatgtggaagcaatcatttgcccactttcttcaccaattacagcaaaagta
ctggaatctgctaaaaatcttaaaatcgtagcgaatattggcgctggttttgacaatatt
gatgtaaaaaaagcgcaagagctgggcatcgcggtaactaacacaccggatgtatccacg
gaagcgacagcggaattaactctcggattgattttagatgtggcgcgaagaatttcagca
ggtgaccgtttatgtcgtgaaacacctgagcaatttaaagggtgggcgccgacattcttt
ttaggtacggaattaagcggtaagactctaggaattataggtttagggagaatcggtcag
gctgttgcaaaacgcgcggctgcttttggaatgaaaatcatttattctgggcaccacccg
aaagaagcagcgaaacagtgggatgcggagtttgtaagtcaggatgaactattaaagcgc
agcgatgttgtgacgattcacgcagcatatagtccgagcttgaaacatttactcaatgaa
actacactaaatacaatgaagtcgagtgcttttttaatcaatgcggctcgcggtcctgtt
gtagaagaatctgcattaattaatgcgctcgaaaaaggtgttattgctggtgctgcgctt
gatgtatttgaatttgaacctaaaattggagctgaactaggcaaactagaaaatgtcgtt
ttaacaccacatatcggtaatgcgaccgtagaaacacgcacagaaatgggtcgaatggcc
atttcgaacgttgaagcagttttagcaggaaaacaaccattacattccgtttactaa

DBGET integrated database retrieval system