KEGG   Listeria innocua (serotype 6a): lin0344Help
Entry
lin0344           CDS       T00067                                 

Definition
(GenBank) similar to phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lin  Listeria innocua (serotype 6a)
Pathway
lin00010  Glycolysis / Gluconeogenesis
lin00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:lin00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lin0344
   00500 Starch and sucrose metabolism
    lin0344
Enzymes [BR:lin01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     lin0344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase Glyco_hydro_10
Motif
Other DBs
NCBI-ProteinID: CAC95577
Pasteur: LIN00344
UniProt: Q92EW4
LinkDB All DBs
Position
complement(358011..359426)
Genome map
AA seq 471 aa AA seqDB search
MHTNTGFPADFLWGGAAAANQFEGAYNVDGKGLSVQDVTPKGGFGQITDGPTPDNLKLEG
IDFYHRYKDDVKLFAEMGFKVFRTSIAWSRIFPNGDETEPNEAGLQFYDDLFDELLAHNI
EPLITLSHYETPLHLSKTYDGWVNRKMIDFYENYVRTVFNRYKGKVKYWLTFNEINSILH
APFMSGGISTSPDKLSQKDLYQAVHHELVASALATKIGHEIMPEAQIGCMVLAMPTYPLT
SNPDDIIAVMEAERKNYFFSDVHVRGAYPGYMKRYFRENNIELDVTEEDLEILKNTVDFI
SFSYYMSTTETADESKRKAGAGNILGGVQNPYLEASEWGWQIDPKGLRVVLNEFWDRYQK
PLFIVENGLGAIDQLEQDENGNYTVNDDYRINYLSAHLSQVKEAIKDGVELMGYTSWGCI
DLVSASTAEMKKRYGFIYVDRNNDGTGTLNRYKKKSFDWYKNVIATNGEDL
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgcatacaaatacaggatttccagccgactttttatggggtggagctgctgccgcaaat
caattcgaaggcgcttacaacgttgatggaaaaggactttccgttcaagatgttactcca
aaaggcggattcggtcaaattactgacggtccaacaccagataacttaaaattagaagga
atcgacttttatcatcgttacaaagacgacgtgaaactttttgctgaaatgggcttcaag
gttttccgtacttccatcgcttggtcccgtatcttcccaaatggtgatgaaactgagcca
aacgaagcaggactacaattttacgatgatttattcgacgaacttctagcacataatatt
gaaccgctaatcactttatctcactatgaaacaccacttcacttatcgaaaacttacgac
ggctgggtaaatagaaaaatgatcgacttctatgaaaactatgtccgcactgtatttaat
cgctacaaaggcaaagtaaaatattggctcacttttaatgaaatcaactcgattttacac
gcaccattcatgagtggcggtatttctacaagcccagataaattatcacaaaaagaccta
taccaagctgtccaccacgaacttgtggcgagcgcgctggctacaaaaattggtcacgaa
atcatgccagaagctcaaatcggctgtatggttctagcaatgccaacttatccgctaact
tccaacccagatgatattattgctgttatggaagcagagcgcaaaaactatttcttctct
gatgttcatgttcgcggcgcttatcctggctacatgaaacgctatttcagagaaaataat
attgaattagacgtaacagaagaagacttagaaatccttaaaaacactgtagatttcatt
tccttcagctattacatgagcacaactgaaacagctgacgagtcgaaacgcaaagctggc
gcaggaaacatcctaggaggcgtgcaaaacccttacctagaagcatccgaatggggttgg
caaatcgatcctaaaggcttacgcgttgtcctaaacgaattctgggatagataccaaaaa
ccacttttcatcgtagaaaacggtcttggcgctatcgatcaactagaacaagacgaaaac
ggcaactacacagtaaatgacgactatcgtattaactatttgagcgcccatttatcgcaa
gtaaaagaagcgattaaagacggcgttgagctgatgggttacacttcatggggctgtatc
gaccttgttagtgcctccactgctgaaatgaagaaacgttacggctttatctatgtcgat
cgcaacaacgacggcacaggtacgctaaatcgttataagaagaaaagttttgattggtac
aagaacgttattgctaccaatggtgaagatttataa

DBGET integrated database retrieval system