KEGG   Listeria innocua (serotype 6a): lin1934Help
Entry
lin1934           CDS       T00067                                 

Definition
(GenBank) similar to putative serine/threonine-specific protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
lin  Listeria innocua (serotype 6a)
Brite
KEGG Orthology (KO) [BR:lin00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lin01001]
    lin1934
Enzymes [BR:lin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     lin1934
Protein kinases [BR:lin01001]
 Serine/threonine kinases: Other
  Bacterial family
   lin1934
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr Haspin_kinase APH Kdo Kinase-like RIO1 Seadorna_VP7 ETRAMP LPD29 DUF3989
Motif
Other DBs
NCBI-ProteinID: CAC97164
Pasteur: LIN01934
UniProt: Q92AI8
LinkDB All DBs
Position
complement(1947899..1949872)
Genome map
AA seq 657 aa AA seqDB search
MMIGKRLNDRYKILHAIGGGGMANVYLAHDIILDRDVAVKILRIDLADESNLIRRFQREA
QSATSLVHPNIVSVYDVGEENDLHYIVMEHVDGMDLKQYIQENHPISYDKAVDIMLQIVS
AVAIAHQHHIIHRDLKPQNILIDHDGVVKITDFGIAMALSETSITQTNSLLGSVHYLSPE
QARGGMATQKSDIYSLGIVLYELLTGKVPFDGESAVSIAIKHLQAEIPSARAQNPEIPQS
LENIIIKATAKDPFLRYQNAEEMEKDLQTCLNKDRLNEPKYVFPTNDDDGDTKTIPIIAT
KEAMQNLDKTIVPEGKVAAEEVAVDDKKGKKKKKMSKKKKIILIVSSVIVLFIIGILLLW
LLGKSPDEVAVPDVSGKTEDQAIALLQKDGFVIGKTAEKNSDDVEEGKVINTDPSAGEMK
EKGTKINLFVSIGSKKITMEDYTGRSYSETKTLLEQQGFNNISAEEAYSSEVGKGMIISQ
TPTQGTEVVAKSTDVKFVVSKGAEPITLKDLRGYTKTAVEDYASPLGLKVSSKEENSNSV
EKGQVISQSPSAGTAINAGDTIEIVISAGPKEKQVKEVTKTFNIPYTPSDEENPQPQKVQ
IYIQDKDHSMTSAYREMNITQNTSVEVTFQIEEGSSAGYKIISDDKVIDEGTVPYPN
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgatgattggtaagcgactaaatgatcgatacaaaattttacatgcgataggcgggggt
ggaatggccaatgtctatcttgcgcatgatataattcttgaccgcgatgtagctgtaaaa
attttacggattgatttagcggatgaaagcaaccttattcgcaggtttcaacgtgaagcc
caatcagcaactagcttagtgcatcctaacattgttagtgtgtacgatgttggcgaagaa
aatgatttacactatatagtgatggaacatgtggatgggatggatttaaaacagtatatc
caagaaaatcacccaattagctatgataaagctgtagacatcatgcttcaaatcgtttca
gcagtagctatcgcacatcaacatcacattattcatcgcgatttaaaaccacaaaatatt
ttaattgatcatgatggagtcgtaaaaattactgattttgggattgcgatggcactttct
gaaacatccatcacccaaacgaattccttacttggctctgtccattacttatcaccagaa
caggctcgcggtgggatggcaactcaaaagtcagacatctattcgctcggaattgtttta
tatgaactcctaactgggaaggtaccttttgacggagaatcggctgtttcaatcgctatc
aaacatttacaagcagaaattccgtctgcaagagcccaaaacccagaaattcctcaaagc
ttagaaaatattattattaaagcaacagcaaaagatccatttttacgttatcaaaacgca
gaagaaatggaaaaagatttgcaaacctgcttaaataaagatcgtctaaatgaacctaaa
tacgtttttccaaccaatgatgatgatggcgacacaaaaacaattccaatcatcgccaca
aaagaagcgatgcaaaatctagataaaaccatcgttccagaaggtaaagtagctgcagaa
gaagtagctgtagacgataaaaaaggtaaaaagaagaaaaaaatgagcaagaaaaagaag
attattttaatcgtgtcttccgtaatcgttcttttcattattggtattttactgttatgg
cttttaggtaaaagtcctgatgaagtcgctgtacctgatgtttctggtaaaacagaagac
caagcaattgccttactgcaaaaagatggctttgttattggtaaaacagcagaaaaaaat
agcgatgacgtagaagaaggcaaagttattaatacggacccatcagcgggtgaaatgaaa
gaaaaaggcacgaaaatcaatttatttgtaagtataggttctaagaaaattacgatggaa
gactatactggtagaagttactctgagactaaaactttgctagagcagcaaggtttcaac
aatatttctgcagaagaagcatatagttctgaagttggtaaaggaatgattattagccaa
acgccaactcaaggaacggaagtagttgctaagtcgacagatgtaaaatttgtcgtaagt
aaaggcgcagaaccgattacacttaaagaccttcgtggctatacaaaaacagctgtagaa
gattatgcttcaccacttggactcaaagtttcgagtaaagaagaaaactccaactcagta
gaaaaagggcaagtaatttcgcaatccccatcagctggaacggcaataaatgcaggcgat
actattgaaatcgttatttctgctggaccaaaagaaaaacaagttaaagaagttacaaaa
acatttaacatcccttatacaccaagcgatgaagaaaatccacaaccacagaaagtccaa
atttacattcaagacaaagatcatagtatgacaagcgcataccgagaaatgaatattacc
caaaatacctcggtagaagtgactttccaaattgaagaaggttctagcgcaggctacaaa
atcatcagtgacgataaagtaatcgatgaaggtacagtcccttatccaaattaa

DBGET integrated database retrieval system