KEGG   Listeria innocua (serotype 6a): lin2528Help
Entry
lin2528           CDS       T00067                                 

Definition
(GenBank) highly similar to glutamate decarboxylases
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
lin  Listeria innocua (serotype 6a)
Pathway
lin00250  Alanine, aspartate and glutamate metabolism
lin00410  beta-Alanine metabolism
lin00430  Taurine and hypotaurine metabolism
lin00650  Butanoate metabolism
lin01100  Metabolic pathways
lin01110  Biosynthesis of secondary metabolites
lin01120  Microbial metabolism in diverse environments
lin02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:lin00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    lin2528
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    lin2528
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    lin2528
   00430 Taurine and hypotaurine metabolism
    lin2528
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    lin2528
Enzymes [BR:lin01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     lin2528
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: CAC97755
Pasteur: LIN02528
UniProt: Q928K4
LinkDB All DBs
Position
complement(2549470..2550873)
Genome map
AA seq 467 aa AA seqDB search
MLYSENDKRKHESYRIPLFGSEEESTSIPKYVLKKEPMEPRIAYQLVKDQLMDEGNARQN
LATFCQTYMEKEAEILMAETLEKNAIDKSEYPQTAELENRCVNILADLWNAPKEMSYLGT
STVGSSEACMLGGLAMKFRWRNNAEKRGLDIQAKRPNLIISSGYQVCWEKFCVYWDVDMR
VVPMDKEHLSLDVEKVFELVDEYTIGIVGILGITYTGKFDDIALLDEKVEAYNEANEHQL
VIHIDGASGAMFTPFVNPELPWDFRLKNVVSINTSGHKYGLVYPGVGWILWKDKEYLPKE
LIFEVSYLGGSMPTMAINFSRSASQIIGQYYNFLRYGFEGYREIHEKTKKTALYLSKTVE
KSGYFEIINDGSNLPIVCYKLKDDLDVEWTLYDLADQLLMKGWQVPAYPLPADLSDTIIQ
RFVCRADLGYNVAEEFAADFADALHNLEHARVLYHDKERNDSYGFTH
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgctttatagtgaaaacgacaagcgaaaacatgaaagttatcgaatcccgctctttgga
tctgaagaagaaagtactagcatcccgaaatacgtattaaaaaaggaaccaatggaaccg
cgcattgcttatcaattagtgaaagatcagctgatggatgaaggaaatgcgagacagaac
ttggcgactttttgtcagacatatatggaaaaagaagccgaaatattgatggcagaaaca
ctggaaaaaaatgctatcgacaaatctgagtatccacaaacagcagaactagaaaatcgc
tgcgttaatattttagcggatttatggaatgcgccaaaagaaatgtcttatctaggcact
tccactgttggttcttcggaagcgtgtatgcttggcggcttggcaatgaaatttcgttgg
cgtaataatgctgaaaaacgtggtctagatattcaagcgaaacggccaaatttaattatt
tcatcaggctaccaagtgtgttgggaaaaattttgtgtgtactgggatgttgatatgcgt
gtcgttccaatggataaagagcatctaagtcttgatgttgagaaggtatttgagttagtg
gatgagtatacgattggtatcgttgggattttaggtattacttacacaggaaaattcgat
gatattgctttattagatgaaaaagtagaagcttataatgaagcaaacgagcatcaatta
gtgattcatattgacggggcaagtggcgcaatgtttactccatttgtaaatccagaatta
ccgtgggattttaggcttaaaaatgtggtttcaatcaatacttctggtcataaatatggc
ttagtttatccgggtgttggttggattttatggaaagataaagaatatttaccaaaagag
cttatttttgaagtgagttatttaggtggttcaatgccaaccatggcgattaatttttcg
cgtagtgctagtcaaattattggtcaatattataatttcttgcgttatggttttgaaggc
taccgagaaattcacgaaaaaacaaagaaaacagcactatatctctcaaaaacggtagaa
aaaagtggctactttgaaattattaatgatggctctaatttgccgattgtctgttataag
ttgaaagatgaccttgatgttgagtggacgctctatgatcttgcggaccagcttcttatg
aaaggctggcaagttccggcttatccgctgccggctgatttaagtgatacgattattcag
cggtttgtttgccgggcggacttaggttataatgtggcagaagaatttgcagctgatttc
gcggatgcactccacaatttagaacatgctagagtgctttatcatgataaggaacgaaac
gattcttacggatttacgcattaa

DBGET integrated database retrieval system