KEGG   Listeria ivanovii subsp. londoniensis WSLC 30151: JL53_08485Help
Entry
JL53_08485        CDS       T03402                                 

Definition
(GenBank) queuine tRNA-ribosyltransferase
  KO
K00773  queuine tRNA-ribosyltransferase [EC:2.4.2.29]
Organism
lio  Listeria ivanovii subsp. londoniensis WSLC 30151
Brite
KEGG Orthology (KO) [BR:lio00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lio03016]
    JL53_08485
Enzymes [BR:lio01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.29  tRNA-guanosine34 transglycosylase
     JL53_08485
Transfer RNA biogenesis [BR:lio03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    JL53_08485
 Prokaryotic Type
    JL53_08485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TGT
Motif
Other DBs
NCBI-ProteinID: AIS62760
UniProt: A0A097B5I5
LinkDB All DBs
Position
complement(1732935..1734074)
Genome map
AA seq 379 aa AA seqDB search
MSAIRYELIKTDKQTGARLGKIHTPHGTFDTPMFMPVGTLATVKTMSPEELKAMGAGIIL
SNTYHLWLRPGEELIREAGGLHKFMNWDQPILTDSGGFQVFSLSKMRDIKEEGVHFRNHL
NGDKLFLSPEKAIQIQNALGSDIMMSFDECPPYPASHEYMKKSVERTSRWAERGLKAHAR
PDDQGLFGIVQGGAYEDLRAQSAKDLVSLDFPGYSIGGLSVGEPKDVMNQVLEHTTPLLP
TNKPRYLMGVGSPDSLIDGVIRGIDMFDCVLPTRIARNGTCMTSNGRLVIKNAKFTHDFR
PIDENCDCYTCKNYSRAYIRHLIRCEETFGIRLTTYHNLHFLLNLMKQVRSAIMEDRLAD
FREEFFEQYGFNRPDAKNF
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccattcgttatgaactaataaaaacagataaacaaacaggtgctcgtctcggt
aaaatccatacaccacatggcacatttgatacgcctatgtttatgccagttggaacactt
gcaacggtaaaaacaatgtcgccagaagaattaaaagcaatgggcgcaggtattattttg
agcaacacctatcacttatggttacgtcccggtgaagaattgattcgagaagcgggcgga
ctacataaatttatgaactgggatcaaccaatcttaacggattcaggtggttttcaggtg
tttagtttgagtaaaatgcgtgatatcaaagaagagggcgttcatttccgtaatcattta
aatggcgacaagcttttcttatcaccagaaaaagcaattcaaattcaaaatgcgctcgga
tcagacattatgatgagttttgatgaatgcccaccatatcctgcctcgcatgaatacatg
aagaaatcggtagaacgaacttcacgctgggctgaacgcggattaaaagcacatgctaga
ccagatgaccaaggattatttggaatcgttcagggcggtgcatatgaagatttgcgcgca
cagagcgctaaagacttagtttcccttgattttccaggatattcaattggcggtttatcg
gttggggaaccgaaagacgttatgaaccaagtactcgaacacacaacaccacttttacca
accaacaagccacgttatttaatgggtgttggttcgccggattcacttatagatggggtc
attcgtgggattgacatgtttgactgtgttcttcctactcgtatagcgcgtaatggtact
tgtatgacatctaatggacgcttagtaattaaaaatgctaagttcacacatgatttccgt
ccaattgatgaaaattgtgattgttatacttgtaaaaattattcacgtgcatacattaga
catttgattcgttgtgaagaaacttttgggattagacttacaacttatcataatcttcat
tttctgttaaacttaatgaagcaggttcgttccgctattatggaagatcgtcttgctgat
tttagggaagaattttttgagcaatacggatttaatcgtcctgatgcaaaaaatttctaa

DBGET integrated database retrieval system