KEGG   Listeria ivanovii subsp. londoniensis WSLC 30151: JL53_09030Help
Entry
JL53_09030        CDS       T03402                                 

Definition
(GenBank) anthranilate synthase subunit I
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
lio  Listeria ivanovii subsp. londoniensis WSLC 30151
Pathway
lio00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lio01100  Metabolic pathways
lio01110  Biosynthesis of secondary metabolites
lio01130  Biosynthesis of antibiotics
lio01230  Biosynthesis of amino acids
lio02024  Quorum sensing
Module
lio_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lio00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    JL53_09030
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    JL53_09030
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    JL53_09030
Enzymes [BR:lio01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     JL53_09030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N DUF494
Motif
Other DBs
NCBI-ProteinID: AIS62866
UniProt: A0A097B5U1
LinkDB All DBs
Position
complement(1849770..1851134)
Genome map
AA seq 454 aa AA seqDB search
MRKFKKMDADTLTAILAFQRLEGQGKSLLEGAAKDADAGRYSIIAVNPVHEIKVYQNDYY
LDGKHKKVADPLKEMETFIQKAKVNEIELPLDSGAIGYVGYDVIALYEELGTIPTENRDM
PDIRFYVYETFVIIDHQAEELILVQDNCYSGRSEAELEEALQQMEQQLITPKKREHDPVY
VAKMTYKSNYTKQEYIDLVQQAKKYIQEGDLFQVVLSQRLEADFTISPFDYYRKLRLLNP
SPYLYFIDFGDTVLIGSSPESLIKTKGQRVITNPIAGTRKRGATKQEDEQLSAELLADEK
ELAEHRMLVDLGRNDIGKIAVTGSVEVPVYLMIERYRFLMHLVSVVEGTLKPELTAIDAL
RSTLPAGTVSGAPKIRAMQRIYEWENVKRGPYAGAVGYLTKNGDSDFALSIRTMVVHAGK
AYVQAGAGIVYDSDPESEYLETLQKAKALLEVGE
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaattcaaaaaaatggatgccgatacgttaacagcgatattagcatttcaaagg
ttagaagggcaaggaaagagcttactagaaggagcagcaaaagatgcggatgcagggcgc
tattctatcattgctgtaaatcctgtccatgaaataaaagtctatcaaaatgattactat
ttagatggaaaacataaaaaggtagcagatcctttaaaagagatggaaacatttattcag
aaagcgaaagtaaatgagatagaattaccactggattcgggtgcaattggctatgttggt
tacgatgtgattgctttatatgaagaactaggtaccattccaacagaaaaccgtgacatg
cctgatattcgtttttatgtatatgaaacttttgttattatcgatcatcaggcagaagag
ttgatattagtgcaagacaattgctactccggcagatcagaggcagaactagaggaagct
cttcaacaaatggagcagcaactaataacacctaaaaaaagagagcacgatccggtatat
gtagcgaaaatgacttataaaagtaattatacaaagcaagaatatattgatttagtacaa
caagcaaaaaaatatattcaagagggagacctttttcaagtagtcctttcgcaacggctt
gaagcagattttaccatttctccgtttgattattaccggaagttgcgtttgctgaacccg
tctccatatctttattttattgattttggggataccgttttaattggttcatcacctgaa
agtttgattaaaacaaaaggtcagcgagtcattaccaatccaatcgcgggaacaagaaag
cgcggggctacaaaacaagaagatgaacaactttctgcggaattattagcggatgaaaaa
gaactggcagagcaccggatgttagtagatttaggtagaaatgacattggaaaaattgca
gtaactggctctgtagaagtaccggtttacctaatgattgaaaggtaccgtttcttaatg
catcttgtttcagtagtagaaggaactttaaaaccggagctcacagcaatagatgcgctt
cggtccacactcccagccggaaccgtgagtggtgcaccaaaaatcagagcaatgcagcga
atttatgaatgggaaaatgtgaaacgtggaccttatgcgggtgcagttggctatttaact
aaaaatggtgactcggactttgctctttcgattagaacgatggtggtacatgctggaaaa
gcttatgttcaggctggtgcaggaattgtttatgattcggatccagaaagtgagtattta
gagacgttgcaaaaagcaaaagcacttttggaggtgggagaatga

DBGET integrated database retrieval system