KEGG   Listeria ivanovii subsp. londoniensis WSLC 30151: JL53_10150Help
Entry
JL53_10150        CDS       T03402                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
lio  Listeria ivanovii subsp. londoniensis WSLC 30151
Brite
KEGG Orthology (KO) [BR:lio00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lio01001]
    JL53_10150
Enzymes [BR:lio01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     JL53_10150
Protein kinases [BR:lio01001]
 Serine/threonine kinases: Other
  Bacterial family
   JL53_10150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr Haspin_kinase APH Kinase-like Kdo RIO1 Seadorna_VP7 LPD29 DUF4519 DUF5383 Orf78
Motif
Other DBs
NCBI-ProteinID: AIS63048
UniProt: A0A097B6C5
LinkDB All DBs
Position
complement(2074662..2076629)
Genome map
AA seq 655 aa AA seqDB search
MMIGKRLNDRYKILHAIGGGGMANVYLAHDIILDRDVAVKILRIDLADESNLIRRFQREA
QSATSLVHPNIVSVYDVGEENDLHYIVMEHVDGMDLKQYIHENHPISYEKAVDIMLQIVS
AVAVAHQHHIIHRDLKPQNILIDHDGVVKITDFGIAMALSETSITQTNSLLGSVHYLSPE
QARGGMATQKSDIYSLGIVLYELLTGKVPFDGESAVSIAIKHLQADIPSARTQNPEIPQS
LENIIIKATAKDPFLRYQNAEEMEKDLQTCLNKDRLNEPKYVFKADDGDTKTIPIIATKE
AMQNSDNTIVPKGKVAAEEVTEEDKKGKKKKKMSKKKKIAWIVFSVIIAFIIAILLLWML
GKGPEEIAVPDVSGKTEDQAIALLQKDGFVIGKTAEKNSDDVEEGKVINTDPDAGEMKEK
GTKVNLFVSIGSKKITMDDYTGRSYDDTKELLEEQGFNNISSEEAYSSDVDKGMIISQTP
SAGTNVVAKSTDVKFVVSKGAEPITLKDLRGYTKTAVEDYASPLGLKVSSSEENSDSVEK
GQVISQSPSSGTTMNPGDTIEIVISAGPKEKAVKEVTKTFNISYTPSDEENPEPQHIQIY
IQDKDHSMTSAYREMDISQNTSVEVTFQIEEGTSGGYKIISDDKVIDEGTVPYPN
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgatgattggtaaacgtctaaatgatcgatataaaatcttacatgctataggcggcggt
ggaatggccaatgtttatcttgctcatgatattattctagaccgtgacgttgcagtaaag
attttacgcattgatttagcagatgaaagtaatcttatacgccgttttcaacgagaagcg
caatctgcaacaagtttagttcaccctaatatagtcagtgtctatgatgttggtgaagaa
aatgacttgcactatatcgttatggagcatgtcgatggaatggacttaaaacaatacatc
cacgaaaaccacccaattagctacgaaaaagcagtcgatattatgctgcaaatcgtttcc
gcagtggctgtcgcgcatcaacaccatattattcaccgcgatttgaaaccgcaaaatatc
ttaattgaccatgatggtgtcgtgaaaattactgattttgggattgcgatggcgctttct
gaaacctctattacccaaacgaattctcttcttggctctgtccactacttatcaccagaa
caagctcgtggcgggatggcaacgcaaaaatcagatatttattcactcggaatcgtttta
tatgaattacttacaggaaaagtaccgtttgacggagaatcagctgtatccattgcgatt
aagcatttacaagcagatattccttccgcaagaacacaaaatccagaaatccctcaaagc
ttagaaaatatcatcattaaagcaactgcaaaagatccatttctccgttaccaaaatgcc
gaagaaatggaaaaagacttacaaacttgcttaaataaagaccgtcttaatgaaccaaaa
tatgttttcaaagcagatgatggtgatacaaaaactatcccaatcattgcaacaaaagaa
gcgatgcaaaattcagataataccattgtccctaaaggaaaagtggccgcagaagaagta
acggaagaagataaaaaaggcaagaaaaagaaaaaaatgagtaagaaaaagaaaattgct
tggattgttttttcagtaattatcgcctttattatcgctatcttattactttggatgctc
ggtaaaggaccagaagaaattgctgtaccagatgtttcagggaagacggaagaccaagcc
attgccttgcttcaaaaagatggttttgtcattggtaaaaccgctgaaaaaaatagcgat
gatgtagaagaaggaaaagtgattaatacggaccctgatgctggtgaaatgaaagaaaaa
ggaaccaaagtaaacttgttcgtaagtatcggttctaaaaaaatcacgatggatgactac
actggtcgaagttatgatgatacaaaagaattactagaagaacaaggctttaataatatt
tcgtccgaagaggcttatagttctgatgtagataaaggaatgattattagccaaacacca
tcagcaggaacgaatgtcgtagcgaaatcgacggatgtaaaatttgtcgtaagtaaaggc
gcagaaccaattaccttgaaagatcttcgcggatatactaaaacagccgtggaagattat
gcgtcacctcttggacttaaagtatccagctcggaagaaaactctgattcagttgaaaaa
ggacaagttatttcgcagtccccttcatctggaaccacgatgaatccaggcgatacgatt
gaaatagttatctctgccggaccgaaagaaaaagcagttaaagaagtaacaaaaacattt
aatatttcctatacaccaagtgatgaagaaaatccagagccacaacatattcaaatctat
attcaagataaggatcatagtatgacaagtgcttaccgtgaaatggatattagccaaaat
acatcggtagaagtcactttccaaatagaagaaggtacgagcggtggctataaaattatt
agtgatgataaagtaatcgatgaaggtacggttccatatccaaactaa

DBGET integrated database retrieval system