KEGG   Listeria ivanovii subsp. londoniensis WSLC 30151: JL53_12605Help
Entry
JL53_12605        CDS       T03402                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
lio  Listeria ivanovii subsp. londoniensis WSLC 30151
Pathway
lio00250  Alanine, aspartate and glutamate metabolism
lio00410  beta-Alanine metabolism
lio00430  Taurine and hypotaurine metabolism
lio00650  Butanoate metabolism
lio01100  Metabolic pathways
lio01110  Biosynthesis of secondary metabolites
lio01120  Microbial metabolism in diverse environments
lio02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:lio00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    JL53_12605
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    JL53_12605
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    JL53_12605
   00430 Taurine and hypotaurine metabolism
    JL53_12605
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    JL53_12605
Enzymes [BR:lio01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     JL53_12605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC DUF3826
Motif
Other DBs
NCBI-ProteinID: AIS63510
UniProt: A0A097BFS6
LinkDB All DBs
Position
2579406..2580800
Genome map
AA seq 464 aa AA seqDB search
MLYSKENQESYLEPIFGSSAEDRDIPKYTLGKEPLEPRIAYQLVKDELLDEGSARQNLAT
FCQTYMEDEATKLMSETLEKNAIDKSEYPRTAELENRCVNIIADLWHAPKEQKFMGTSTI
GSSEACMLGGMAMKFTWRNRAEKLGLDIHAKKPNLVISSGYQVCWEKFCVYWDIDMRIVP
MDKDHMQLNTDQVLDYIDEYTIGVVGILGITYTGRYDDIYALNEKIEQYNSQTDYKVYIH
VDAASGGFFTPFVEPDIIWDFRLKNVISINTSGHKYGLVYPGIGWVLWKDENYLPKELIF
KVSYLGGEMPTMQINFSRSASHIIGQYYNFLRYGFEGYRTIHQKTSDVAQYLANAVKQTG
YFDIYNDGSHLPIVCYKLKEDANISWTLYDLADRLQMRGWQVPAYPLPKSLENVIIQRYV
CRADLGFNMAEEFIQDFKASIHELNNAHILFHDKQQSGVHGFTH
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgttatatagtaaagaaaatcaagaaagttatttagaacccatttttggatccagcgca
gaggatcgtgatattccaaaatatactctcggaaaagaacctttagaacctcgtatcgct
tatcaattagtgaaagatgaactattagatgaaggatctgctcgtcaaaatttagctact
ttttgccaaacatatatggaagacgaagctaccaaattaatgtccgaaaccttagaaaaa
aatgccattgataaatcggagtatccacgaacagcggaacttgaaaatcgctgcgttaat
attattgcagatttatggcacgcaccaaaagaacaaaaattcatggggacttctacaatt
ggctctagtgaagcttgtatgttaggtggaatggcgatgaaattcacttggcgaaatcgt
gcagaaaagctaggcctcgatattcatgccaaaaaaccaaaccttgtcatttcttccggt
taccaagtttgttgggaaaaattctgtgtttactgggatattgacatgcggatcgtacca
atggataaagaccatatgcaactaaataccgaccaagtgttagactatattgatgaatat
actatcggcgtcgtcggtatccttggtattacctacacgggacgttacgacgacatctac
gcccttaatgagaaaattgaacaatacaacagccaaacagattacaaagtatacatccac
gttgatgcagcaagcggaggtttctttaccccatttgtggaacctgacatcatttgggac
ttccgtttaaaaaatgttatttctattaacacttctggacataagtatgggttagtctat
cctggtattggctgggtgctttggaaggatgaaaactatttgccaaaagaactcattttc
aaagttagttatcttggcggagaaatgccaacaatgcaaatcaatttttctaggagcgct
agccatattatcggccaatattataatttcctacgctatggctttgaaggctaccggacc
attcatcaaaaaacaagtgatgttgcacaatatcttgcaaatgccgtaaaacaaactggt
tatttcgacatttataatgacggctcccatttgccaattgtctgctataaattaaaagaa
gatgcaaacattagttggacgctttacgatttagctgaccgcttgcaaatgcgcggatgg
caagtaccagcttatccactaccaaaaagtttagaaaacgttattattcaacgctatgtt
tgtcgagctgaccttggtttcaatatggctgaagaatttatccaagatttcaaagcttct
atccacgaactaaataacgcccacatccttttccatgataaacagcaatccggtgttcat
ggcttcacgcactaa

DBGET integrated database retrieval system