KEGG   Listeria ivanovii subsp. londoniensis WSLC 30151: JL53_12750Help
Entry
JL53_12750        CDS       T03402                                 

Definition
(GenBank) aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Organism
lio  Listeria ivanovii subsp. londoniensis WSLC 30151
Pathway
lio00260  Glycine, serine and threonine metabolism
lio00261  Monobactam biosynthesis
lio00270  Cysteine and methionine metabolism
lio00300  Lysine biosynthesis
lio01100  Metabolic pathways
lio01110  Biosynthesis of secondary metabolites
lio01120  Microbial metabolism in diverse environments
lio01130  Biosynthesis of antibiotics
lio01210  2-Oxocarboxylic acid metabolism
lio01230  Biosynthesis of amino acids
Module
lio_M00017  Methionine biosynthesis, apartate => homoserine => methionine
lio_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
lio_M00525  Lysine biosynthesis, acetyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:lio00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    JL53_12750
   00270 Cysteine and methionine metabolism
    JL53_12750
   00300 Lysine biosynthesis
    JL53_12750
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    JL53_12750
Enzymes [BR:lio01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     JL53_12750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase ACT_7 ACT DUF3394 Fe_hyd_SSU
Motif
Other DBs
NCBI-ProteinID: AIS63520
LinkDB All DBs
Position
2596586..2597947
Genome map
AA seq 453 aa AA seqDB search
MKVIKFGGSSLASGIQLNKVFQLVAEDSDRKIVVVSAPGKRFKEDTKVTDLLIDCATKAL
LGENTTELFEAVIARYAGIALDTGMDGAIIQQIRTDLQATISSDKSDPDKFLDRMKASGE
DNNAKLIAAYFKFKGLNANYINPKDAGLLVTNEHASAQVLPESYDRLFALREREGIIVFP
GFFGYTKDGEISTFSRSGSDITGAIVANGAQAELYENFTDVDAVYAVNPAIVKNPKKVLE
LTYREMRELSYAGFSVFHDEALIPAFHAGIPVHIKNTNNPDSCGTRVVHERENSNGPVVG
IASDDGFCSIYISKYLMNREIGFGRKVLQILEDSGLNYEHMPSGIDDLTIIIRENQFGED
TEQTIMARLKEELNADQVIMQHGISLIMVVGETMRHNVGITSRASKALSDAKVNIEMINQ
GSSEVSIMFGVKEAQENTAVRALYNEFFSEVLV
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaattaaatttggcgggagttctttagcatcagggattcaattaaataaagtt
ttccaacttgtagcggaggattctgatcgaaaaatcgttgttgtatcagctcctggtaaa
cgtttcaaagaagatacaaaagtgacggacttacttattgattgcgcgacaaaagcactt
ttaggagaaaatacgacagaattatttgaagctgtcattgctagatatgcgggaattgcg
cttgatacgggaatggatggtgcgattatccagcaaattcgtacagatttacaagcgaca
atttcttctgacaaaagcgatcctgataaatttttagatcgaatgaaagctagcggagaa
gataacaatgcgaaattaatcgcagcttattttaaatttaaaggcttaaatgccaactat
attaatccaaaagatgctggattactcgtgacgaacgaacatgcaagtgctcaagtttta
cctgaatcttatgaccggttgtttgcacttcgagaacgagaaggtatcatcgttttccct
ggatttttcggttacacaaaagacggcgaaattagtactttttccagaagtggttctgat
attactggagcgattgtggccaatggggcgcaagctgagttatacgagaattttactgat
gtggatgcagtttatgcagtcaatccggctattgtaaaaaacccgaagaaagtactcgaa
cttacttaccgcgaaatgcgcgaactttcttatgctggcttctctgtttttcatgacgaa
gccttgattccggccttccatgcagggattcctgttcatatcaaaaatacaaacaatcct
gattcatgcggaactcgtgtcgtacatgaacgtgaaaacagcaatgggccagtcgttgga
attgcgagcgacgacggtttttgcagcatttatattagtaaatatttaatgaaccgggaa
attggctttggtcgaaaagtgttacaaatcttggaagactctgggctgaactatgagcat
atgccatccggaattgatgatttaactattattattcgcgaaaatcagtttggcgaggac
accgaacagacaattatggctcgattgaaagaagaattaaatgccgatcaagttattatg
caacatggaatttcactgattatggttgtaggcgaaacaatgcgccataacgttgggata
acttcacgtgcttctaaagctttatccgacgcaaaagtaaacattgaaatgattaatcaa
ggctcttcagaagtaagcattatgttcggcgtcaaagaagcacaggaaaatacagcagtt
cgggcgctatataatgaattcttttcggaggttttggtttaa

DBGET integrated database retrieval system