KEGG   Listeria ivanovii subsp. londoniensis WSLC 30151: JL53_13035Help
Entry
JL53_13035        CDS       T03402                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
lio  Listeria ivanovii subsp. londoniensis WSLC 30151
Pathway
lio00250  Alanine, aspartate and glutamate metabolism
lio00410  beta-Alanine metabolism
lio00430  Taurine and hypotaurine metabolism
lio00650  Butanoate metabolism
lio01100  Metabolic pathways
lio01110  Biosynthesis of secondary metabolites
lio01120  Microbial metabolism in diverse environments
lio02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:lio00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    JL53_13035
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    JL53_13035
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    JL53_13035
   00430 Taurine and hypotaurine metabolism
    JL53_13035
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    JL53_13035
Enzymes [BR:lio01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     JL53_13035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AIS63577
UniProt: A0A097BFY6
LinkDB All DBs
Position
complement(2645887..2647290)
Genome map
AA seq 467 aa AA seqDB search
MLYSENDKRKHESYRIPLFGSEEESTSIPKYVLKKEPMEPRIAYQLVKDQLMDEGNARQN
LATFCQTYMEEEAQLLMAETLEKNAIDKSEYPQTAELENRCVNILADLWNSPKEMAYLGT
STVGSSEACMLGGLAMKFRWRKNAKKRGLDIQAKRPNLIISSGYQVCWEKFCVYWDVDMR
VVPMDKEHLSLDTDRVFDFVDDYTIGIVGILGITYTGKFDDIALLDEKVEAYNETNEHQL
VIHVDGASGAMFTPFVNPELPWDFRLKNVVSINTSGHKYGLVYPGVGWILWKDKEYLPEE
LIFEVSYLGGSMPTMAINFSRSASQIIGQYYNFLRFGFEGYREIHEKTKETALYLAKTVE
KSGYFDIINDGSNLPIVCYKMKEDLDVEWTLYDLADQLLMKGWQVPAYPLPADLSDTIIQ
RFVCRADLGHNVAEEFAADFHEALHNLEHARVLYHDKGRNDSYGFTH
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgctttatagcgaaaacgacaagcgaaaacatgaaagttatcgaattccactctttggt
tccgaggaagagagcacgagtattccgaaatatgttttaaagaaagagccaatggaaccg
cgtattgcctatcaacttgtgaaagatcagttgatggatgagggaaatgctagacaaaac
ttagcgactttttgccaaacatacatggaagaagaagcgcagttacttatggcagaaaca
ctcgaaaaaaatgcgatagataagtcggaatatccgcaaaccgcagaactcgaaaacaga
tgtgttaatattttagctgatttatggaattcgccgaaagaaatggcttatttaggcact
tccactgttggatcctctgaggcatgtatgcttggtggcctagcaatgaaatttagatgg
cgtaaaaatgccaaaaaacgtgggttagatattcaagcaaaacggcctaatttgattatt
tcttcagggtatcaagtttgttgggaaaaattttgtgtgtattgggatgttgatatgcgt
gtagtaccaatggataaagaacatctaagcttagacacggaccgggtatttgattttgta
gatgattatacaattggtattgttgggattttaggcattacttatactgggaaatttgat
gatattgcattattggatgaaaaagtggaggcatacaatgaaacaaatgaacatcaacta
gtgattcatgtggacggagcgagtggcgcgatgtttacgccctttgtaaatccagaattg
ccatgggacttccgattgaaaaatgttgtttcaattaacacatcaggtcataaatatggt
cttgtatatccaggtgttggttggatactttggaaggataaagaatatttaccagaagaa
ttaatttttgaagtgagttacttgggtggttcaatgccaacgatggcgattaatttctct
agaagtgctagccaaattattgggcagtattataatttcttgcggtttggttttgaaggt
taccgagaaattcacgagaaaacaaaggaaacagcactttatcttgcaaaaacagtagaa
aaaagtggctattttgatattatcaatgatggttctaacttaccgatagtttgttataaa
atgaaagaagatttggatgttgaatggacattatatgacttagcagatcaacttttaatg
aaaggctggcaagttccggcgtacccactaccagctgatttaagtgatacaattattcaa
cgttttgtttgccgggcagatttaggtcataatgttgccgaagaatttgcagctgatttt
cacgaggcgttgcataacctagaacatgcgagagtactctatcatgataaagggcgaaat
gattcatacggatttacgcattaa

DBGET integrated database retrieval system