KEGG   Listeria ivanovii subsp. londoniensis WSLC 30151: JL53_14260Help
Entry
JL53_14260        CDS       T03402                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
lio  Listeria ivanovii subsp. londoniensis WSLC 30151
Pathway
lio00040  Pentose and glucuronate interconversions
lio00051  Fructose and mannose metabolism
lio01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lio00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    JL53_14260
   00051 Fructose and mannose metabolism
    JL53_14260
Enzymes [BR:lio01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     JL53_14260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C ApbA TrkA_N UDPG_MGDP_dh_N 2-Hacid_dh_C ThiF
Motif
Other DBs
NCBI-ProteinID: AIS63802
UniProt: A0A097BGK4
LinkDB All DBs
Position
complement(2881306..2882358)
Genome map
AA seq 350 aa AA seqDB search
MRAAVLYENNVIKAEQIDEAVCEKDQVRVEVKAVGICGSDIHKMQTRWKYPLPAVMGHEF
SGVITEVGSEVENRAIGDRVAGIPLEPCMECNYCKAGDFSLCDNYRMVGSHFHGGFAENV
VMKADNVISIGDLDFEEGAMIEPLAVSMHGVLGIEPRLGDTVIVFGIGTIGILVVQCLLL
AGVKDIIAVDISDKKLADAKEFGCRYTINPKNEDLKERVLAYTNGLGADIALECAGSKIT
QEQCLLVTKKKGKVGFLGIAYADVLLHEEAFENIFRRELTLKGFWNSYSAPFPGEEWRTS
IEFVKQGRIKLKPLISHRYKLEETKEAFEMILSREHDYNKVMILPQKGDD
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgcgagcagctgtgttatacgagaataatgtaataaaagcagaacaaattgatgaagcg
gtttgcgagaaagatcaagtacgtgtggaggtaaaagcggtcggaatatgcggatcagat
attcacaaaatgcagacgcgctggaaatatccactgccggctgttatgggacacgaattt
tcgggtgtgattacagaagtaggtagcgaagtggaaaatagagctatcggtgaccgtgtt
gcaggtattccactagaaccatgtatggaatgtaattattgtaaagcgggcgacttctcg
ctatgtgacaattaccgcatggtgggctcacatttccacggaggatttgccgaaaatgtg
gtaatgaaagctgataacgtcatttctattggcgaccttgattttgaagaaggtgcaatg
attgaaccactagctgtgtcaatgcatggggtacttggaatcgaaccaagacttggtgat
acagttatcgtgtttgggattgggacgattggaattttagtcgtgcaatgtttacttctc
gctggtgtgaaagatattatcgctgttgatatcagtgataagaagttagcagatgcgaag
gaatttggttgcagatacacgattaatccaaaaaacgaagacctgaaagaacgcgtttta
gcttatacgaatggtcttggtgctgacatcgcgctagaatgtgccggttccaaaatcacc
caagaacaatgtctccttgtaacgaagaaaaaaggcaaagtcggtttcctcggaatagct
tacgcagatgtacttttacatgaagaagcttttgaaaatattttcagacgcgaattaacg
cttaaaggtttttggaactcttactcggcgccgtttccaggtgaagagtggcgtacttcg
atagaatttgtcaaacaaggtcgaattaaactaaaaccactgatttcgcatcgttataaa
ctagaagaaacgaaagaagcgtttgagatgattctttcaagagaacatgattataacaaa
gtgatgatattgcctcagaaaggtgacgattaa

DBGET integrated database retrieval system