KEGG   Lawsonia intracellularis N343: LAW_00042Help
Entry
LAW_00042         CDS       T02437                                 

Definition
(GenBank) hypothetical protein
Organism
lir  Lawsonia intracellularis N343
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LPD38
Motif
Other DBs
NCBI-ProteinID: AGC49443
LinkDB All DBs
Position
50406..53108
Genome map
AA seq 900 aa AA seqDB search
MTKVGGSNPFSTLASMVGFSKSSSSSSSSKVAELKSKFEALGTLTKASPRPANGTQDTNR
LSDRLFRGHYTVPANTASRVGGHLQRVDDNKSSSSAANVAKRAAAHSSFASSNPGLQGAS
GSSSGGTGGSITDQVKSRGITARNFSDSNNNSIGSGSSSGSILDQVRSQGITARGSSISS
GNASGTSNVNDGTSSRDYGANVRNTRERFEAGPGGAQGESPGVKDAKEATKGVSVSNLRG
IFEGRGGADNNQVGRSSGGVSGASGSGGAQGTGGTSGLGGAQGTLGSGGLDGGGVSGAAG
GTSGASGAGGARGTADGITSPGAREAQETIKNAGVSVRDLAGRFSGAQGTSGASGAAGAS
GASGAGGAAGAAGGGGLDRGGVSGSAGGTSGTSGAGGARGTADGITSPGAREAQETIKNA
GVSVRDLAGRFSGAQGTSGASGASGAAGVAGMPAGSGDVVDGLRRGGEDTVDGFGRNQGS
GPIPSSADFVDGPIGGIQGAGGASGAAGAAGASGAAGASGAAEPLPTNGTDQQIAEVVVR
NAENGHFDGIDFSTQPGGVESNTGSIPGTDLIVQRDITPGEQGVYNNLSEMGSWMDSPNA
SPTNAPESLTDDHSVLTTLLNNKEGLQDTVPFPLAVGEGTVVTKTLDPDIDTSKIKIPLE
IVFGSGSMYGSGIGGGSSTISSSMSDDGSSSIGSTTRKNRAGEIISRIAMNQSPGAGSGG
QTVVGGLGSGSSNINISGGRGGIVYGPMPNVNVVAGDGLNRLQLGSGINPLALLQERMVN
FSAAQLEHLHGQLTGMMAMMEAMPGVAFEGASVQMTLPEPGDTQTMPSIRLSGFGEPRLR
ENIGQPGQPPTQEAFDALRNGPLNGVSELMSQVQEMITVRSEGSISLSRSSSLSDLSSEI
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atgactaaagttggtggtagtaatcctttttcaacacttgcatcaatggttggctttagc
aaatcttcttccagctcatcttcaagtaaggtagctgaattaaaaagtaaatttgaagca
cttgggacactaacaaaagcaagtcctcgtcctgcaaatggcactcaggatactaatcga
ttaagtgatagactatttagaggacactatacagttcctgctaatacagcttcaagagta
ggtggtcatcttcagcgggttgatgacaataaaagtagcagttcagcagctaatgttgca
aaaagagctgcagcacattcttcttttgcaagttcaaacccaggactccaaggagctagc
ggttcttcttctggaggaacaggcggaagtataacagatcaagttaaaagtaggggaatt
actgcaaggaatttttcggattctaataataattctataggatcagggtcaagcagtgga
agtatattagatcaggttagaagtcaaggtattactgccagaggatcatctatttcttct
ggtaatgcatcaggtactagcaatgttaatgatggaacaagttcaagagattatggagct
aatgtccgtaatactcgtgaaagatttgaagctggtcctggaggtgctcaaggagagtct
cctggagtaaaagatgctaaagaagctactaaaggagttagtgtttctaatttaagagga
atatttgaaggaagaggtggtgcagataataatcaagtaggtagaagctctggtggagtt
tcaggagcatcaggatcaggaggagctcaagggacaggaggaacatcgggattaggtgga
gcacaaggtacattaggaagtggaggtcttgatggaggaggagtttcaggtgctgctggt
ggaacttcaggcgcctcaggagccggaggagcaagaggtactgctgatggaataacgtct
cctggagcaagagaagcacaagaaactattaaaaatgctggtgttagtgtaagagattta
gctggaagatttagtggagctcaaggtacaagtggagcttcaggagcagcgggagcttca
ggagcctcaggagccggaggagcagctggtgcggcaggaggtggaggtcttgatagagga
ggagtttcaggttctgctggtggaacttcaggcacctcaggagccggaggagcaagaggt
actgctgatggaataacatctcctggagcaagagaagcacaagaaactattaaaaatgct
ggtgttagtgtaagagatttagctggaagatttagtggagctcaaggtacaagtggagct
tcaggagcttcaggagcagctggtgtggcaggaatgccagcaggtagtggagatgttgtt
gatggactaagaagaggaggagaagatactgtcgatggatttggaagaaatcagggtagt
ggtcctatccctagttctgcagattttgtagatggtcctataggcggtatacaaggagct
ggaggagcttcaggagcagcgggagcagctggtgcttcaggagcagcgggagcttcagga
gcagcagagccacttcctactaatggtacagatcagcagatagctgaagtcgttgtaaga
aatgcagaaaatggtcattttgatggtattgatttctcgacacagcctggtggtgtagaa
tcaaatacaggtagtatccctggaacagatcttattgtccaacgagacatcactcctgga
gaacaaggagtgtataataatctcagtgagatgggatcatggatggatagccctaatgct
agtcctacaaatgcaccagagtctcttacagatgatcatagtgttttgactacactactt
aataataaagaaggcctacaagatactgttccttttcctcttgctgtgggtgaaggcact
gttgttactaaaactcttgatccagacattgatacaagtaagattaaaatcccacttgaa
attgtttttggttctggaagtatgtatggttctggtattggaggaggtagtagtacaatt
agctcctcaatgtctgatgatggaagttctagcataggatcaactacacgtaaaaataga
gcaggtgaaataataagtagaattgcaatgaatcaatcacctggcgctggtagcgggggt
caaactgtagttggtggtcttggttctggtagtagtaatatcaatataagtggtggacgt
ggtggtattgtttatggaccaatgcctaatgtgaatgtagtagctggagatggccttaat
agactacagcttggtagtggaataaatccattagcacttcttcaggaaagaatggttaat
ttttctgctgctcaactagagcatttacatggccaacttacaggtatgatggctatgatg
gaagctatgcctggcgtagcatttgaaggtgcaagtgtccaaatgacattacctgaacca
ggtgatacacagactatgcctagtataaggctatcaggttttggagagccaaggttgcgg
gaaaatataggacagccagggcaacctccaacacaagaagcatttgatgcattaaggaat
ggtccactaaatggagtaagcgagttaatgagccaagttcaagaaatgataactgtaagg
agtgaaggaagtatttcactaagcagaagtagtagtttatcagatttaagttcagaaata
taa

DBGET integrated database retrieval system