KEGG   Leptospira interrogans serovar Linhai: LIL_11617Help
Entry
LIL_11617         CDS       T03859                                 

Gene name
ccmA3
Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
lis  Leptospira interrogans serovar Linhai
Brite
KEGG Orthology (KO) [BR:lis00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lis02000]
    LIL_11617 (ccmA3)
Transporters [BR:lis02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    LIL_11617 (ccmA3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_23 AAA_22 DUF4162 AAA_27 MukB AAA_29 RsgA_GTPase RecA AAA_16 AAA_30
Motif
Other DBs
NCBI-ProteinID: AJR14219
UniProt: A0A0C5WP40
LinkDB All DBs
Position
1:complement(1918882..1919820)
Genome map
AA seq 312 aa AA seqDB search
MGTISVSQLSKSFANKNAVSGISFEIPKGRITGLLGPNGAGKTTTLRLLTGSLHPDKGTI
RYDGFDFYENKIEIQKKIGYLSESSPIYWNLTVFEYLSFLGKAKGIFKKNLKEKIDFVSS
LLQLETVLHSPIGFLSKGFRQRIALAGSLIQDPEYIFLDEPSSGLDPIQIVEFKKLVRIL
GKTKTILFSSHVLQEIEELCDHVLILYKGKLISDRPLNSISQNRPCLILAKTDPETFKSF
FSLTDYKIETTGRTENYFLEFRIQSEKLSSEEIFQILKNASFPIRSINPEKNSLESVFKS
LTTNKPNETFRI
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgggaacgatttcagtcagtcaactttcaaaatcctttgccaataaaaacgctgtttct
ggtattagttttgaaattcccaaaggaagaattaccggtttacttggacccaacggagcc
ggtaaaactaccaccttaagattgttaaccggttccctacatccagacaaaggaacaatt
cgatacgacggttttgatttttatgaaaataaaattgaaatccaaaaaaagataggttat
ctttccgagtcttctcctatttattggaatcttacagtttttgaatatctttcctttttg
ggaaaggcaaaaggaattttcaaaaaaaatctaaaagaaaaaatcgattttgtttcctca
cttttacaattggaaacggttctccacagcccaatcggttttctttctaaaggatttcgt
caaagaatcgccttggcgggaagcttaattcaagatcctgaatatatatttttggacgaa
cccagctctggtttggatcctattcaaattgtggaatttaaaaagctggtccgtatatta
ggaaaaacgaaaacaattcttttttcttctcacgttttacaagaaatagaagaactatgc
gatcacgttctcattttatacaaaggaaaattgatttccgatcgtcctttaaattctatc
tctcaaaatagaccctgtctaatattagcaaaaacagatcctgaaacttttaaaagtttt
ttttcgcttaccgattacaaaatagaaactaccggaagaacggaaaattattttttagaa
tttagaatccaatccgaaaaattatcttcggaagaaatctttcaaattttaaaaaacgca
agttttccgattcggtctataaaccctgaaaaaaattccttagaatccgttttcaaatct
ttaacgacaaacaaaccaaatgagacttttagaatttag

DBGET integrated database retrieval system