KEGG   Leptospira interrogans serovar Linhai: LIL_11819Help
Entry
LIL_11819         CDS       T03859                                 

Gene name
glpA2
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
lis  Leptospira interrogans serovar Linhai
Pathway
lis00564  Glycerophospholipid metabolism
lis01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lis00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    LIL_11819 (glpA2)
Enzymes [BR:lis01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     LIL_11819 (glpA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 GIDA Pyr_redox_2 NAD_binding_8 FAD_binding_3 Thi4 HI0933_like 3HCDH_N Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AJR14421
UniProt: A0A0C5X2J3
LinkDB All DBs
Position
1:2140895..2142547
Genome map
AA seq 550 aa AA seqDB search
MQICRGKETCKAGRVLKMEKQKRVDQISKLQKESFDILVIGGGSTGAGAAFDAAKRGYKT
ALIERKDFASGTSSRSTKLIHGGVRYLAQFHFKLIHEALTERQRLLENAPHLVKPLKFVL
PAYRFYERPYYGIGLTLYDILASKGKLPSHKTVSKSETISEFKAIKKDGLFGGITYYDAQ
FNDARLNVLLARSAQKEGAVVANRIELVSFIKKSGKIVGANLKDLETAKTFPVYTKVIAN
TTGIWVDHVRKLDDPRTFNVLSPSQGIHLVFSKERVPCTSAMIIPKTKDGRVVFIIPWED
HVILGTTDTPIENPGEEPLPIGNEVQFLLDTGNEYLENPVTEKDILSVFVGIRPLISPEG
NQDTKNISREEVILVSNSGLVTMGGGKWSTYRKMAEDLVDKLIQIGNLEVREKCSTKFYV
YPGAADYSESLYQEIEKTYKIDTIFAKRLQNYYGTEVFEVLGKKPKLLGKGIPYFEEEVL
FAVNEEFALGVTDVLARRFRILFVDLSLAQKMVAPVAMVLSKQLKWKDKTKKAEESAAME
LIESLRKSYR
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatttgtagggggaaagaaacctgtaaagcaggaagagttctcaaaatggaaaaa
caaaaacgagtcgatcaaatttctaaactacaaaaagaatcctttgatattttagtaatc
ggaggtgggtctacaggtgctggagccgctttcgacgcagcaaaaagaggttataaaaca
gctctgattgaaagaaaagattttgcttcgggaacttcttcccgttccaccaaactgatt
catggtggggtccgttatttagctcagttccattttaaattgattcacgaggctttgacg
gaaaggcagaggttattggaaaacgcacctcacttagtcaaacctcttaagttcgtttta
cctgcatatcgattttacgaaagaccgtattacggaatcggtcttactctctatgatatt
cttgcgtctaaaggaaaacttccttctcacaaaacggtttctaaatccgaaacaatttcc
gagtttaaagccatcaagaaggacggtttatttggtggaattacctattacgacgctcag
tttaatgatgctcgtttgaatgttcttttggcaagatctgcacaaaaagaaggagccgta
gttgccaatcgaatagaactcgtttcttttattaaaaagagcggaaagattgtaggagcc
aatctcaaagatttagagaccgcaaaaacctttccagtttatacaaaggtaatcgcaaat
acaactggaatctgggtagatcacgttcgtaagttagacgatccaagaacgtttaacgtg
ctttctcccagccaagggatccacttagtattctccaaagaaagagttccttgtacatcc
gccatgatcattccgaaaacaaaggatgggcgagtcgtatttatcattccttgggaagac
cacgtaattcttggaaccacggatactccgattgaaaatccaggagaagaaccacttccg
atcggaaatgaggttcaatttttattggatactggaaacgaatatttggaaaatccagtc
actgaaaaagatattctttccgtgtttgtaggaattcgtcctttgatttcaccagaggga
aatcaggatacgaagaatatttcgagagaggaagtgattttagtttctaattccggtttg
gttacgatgggaggaggaaaatggtccacttacagaaagatggctgaggatttggtggat
aaactcattcagatcggaaatctagaagttagagaaaaatgttctactaaattttatgtt
tatcctggagctgcagattattcagaatctctttaccaggaaattgaaaaaacatataag
atcgatacgatctttgcaaaaaggcttcaaaattattatggaacggaagttttcgaagtt
ttgggaaaaaaaccgaaactattgggaaaaggaattccgtatttcgaagaggaagttttg
tttgcggttaacgaagaatttgcgttaggcgtcacggacgttcttgcaagaagatttaga
attctatttgtagatctcagtttggcgcagaagatggtcgctcctgtggctatggttctt
tccaaacaactcaagtggaaggacaaaacaaaaaaagcggaagaatccgctgcaatggag
ctaatcgaaagtttgaggaagtcgtatcgataa

DBGET integrated database retrieval system