KEGG   Leptospira interrogans serovar Linhai: LIL_12022Help
Entry
LIL_12022         CDS       T03859                                 

Gene name
aceF2
Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lis  Leptospira interrogans serovar Linhai
Pathway
lis00010  Glycolysis / Gluconeogenesis
lis00020  Citrate cycle (TCA cycle)
lis00620  Pyruvate metabolism
lis01100  Metabolic pathways
lis01110  Biosynthesis of secondary metabolites
lis01120  Microbial metabolism in diverse environments
lis01130  Biosynthesis of antibiotics
lis01200  Carbon metabolism
Module
lis_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lis00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LIL_12022 (aceF2)
   00020 Citrate cycle (TCA cycle)
    LIL_12022 (aceF2)
   00620 Pyruvate metabolism
    LIL_12022 (aceF2)
Enzymes [BR:lis01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     LIL_12022 (aceF2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AJR14624
UniProt: A0A0C5WQC2
LinkDB All DBs
Position
1:2376166..2377524
Genome map
AA seq 452 aa AA seqDB search
MAKIAEMTQLSPTMAEGKIVRWLKQKGDPVSPGEIIAEVETDKAVMEMEAFETGILLEIL
APEGTLLPVGAPVAIIGKQGEDVSALVETAKKESSITQGQAPTSTQNATSQSSTTSGANT
VKNLTTKASDASSQNTESNGLTTHEERSLKTQIPFDSEDSPIRSARGGRSIKASPLAKNL
ALQKGVDLGEVIGSGPGGRIIKRDLLAYQESGSVKKSTFVKRQDRKLEITGMRKTIASRL
AHSTSTIPHFYLTLELDATPLDTLRNSYNKDLKLEGSSKISLNDLIIKACSLSLKEVPEV
NSSWREDHILEHGRIDIGVAVSIEGGLITPYIRNADQKSVSEIGREIKELASRARERKLK
PAEYTDGTFTVSNLGMFGISSFTAVINEPEAAILAVGALVEKPVLKEGSIVVGKTLNVTL
SCDHRVVDGATGARFLSSFRDYTEYPLRLLTG
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaattgcagaaatgactcaactcagtcctacaatggcggaaggtaaaatagtc
cgttggcttaaacaaaaaggggatccggtttctccgggagaaatcatagcggaagtggaa
acggataaggcggttatggaaatggaagcctttgaaacggggattcttctggaaattttg
gctccagaagggacacttctcccagtaggcgcccccgtagcgattattggaaaacaagga
gaagacgtttccgcgttagttgaaaccgcaaaaaaagaaagttcgattacgcaaggccag
gccccaacttccacacaaaacgcaacctcgcagtcttctacaacttccggcgcaaacaca
gtaaaaaatctcacaacaaaagcaagcgacgcgtcttcgcaaaataccgaaagcaatggg
ctaaccacgcacgaagaacggtctctcaaaacacagattccgttcgactcggaagattct
cccattcgatcggcgcgcggtggtcgttcgataaaggcatctcctttggcaaaaaacttg
gctcttcaaaaaggagtggatttaggagaagtgattggttccggaccaggaggaagaatt
atcaaaagagaccttctcgcctatcaagaatcgggaagtgttaaaaaaagcacttttgtt
aagcgacaagatcgtaaattagaaataaccggaatgagaaagacaatcgcatcccgtctt
gcacattctacttctacgattcctcatttttatcttactttagagttggacgcaactccg
ttagacactcttagaaattcttataacaaagatctaaaactggaaggctcttcaaaaatt
agtttaaacgacctaattatcaaagcctgttccctttctttaaaagaggttccagaagta
aattcttcctggagagaagatcatattcttgaacacggtagaatcgacataggagttgca
gtttccatagaaggtggtctaatcactccttatattagaaatgcagatcaaaaatcagta
agcgaaattggtcgtgaaataaaagaacttgcttcccgtgccagagaaagaaaactcaaa
ccagcggaatacactgacggaacctttaccgtctccaatcttgggatgtttggaatttct
tcttttactgcagtcatcaatgaaccagaagctgcaattcttgcggtcggagcactcgtt
gaaaaaccagttcttaaagaaggaagtatagtcgtaggaaaaacactaaacgttactctt
tcttgcgatcatagagttgtagacggagcaaccggagctagatttttatcttcttttcga
gattatacggaatatccccttcgcctacttacaggttaa

DBGET integrated database retrieval system