KEGG   Litoreibacter sp. LN3S51: FPZ52_12625Help
Entry
FPZ52_12625       CDS       T06129                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
lit  Litoreibacter sp. LN3S51
Pathway
lit02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:lit00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    FPZ52_12625
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lit02000]
    FPZ52_12625
Transporters [BR:lit02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    FPZ52_12625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY AAA_21 AAA_16 SMC_N AAA_29 RsgA_GTPase AAA_5 AAA TsaE NACHT DUF815
Motif
Other DBs
NCBI-ProteinID: QDY70710
UniProt: A0A5B8J8W8
LinkDB All DBs
Position
unnamed1:260436..261452
Genome map
AA seq 338 aa AA seqDB search
MEIREHPVAPDDVLTVDDLRAYYMVDGYGISRQVKAVDGATLRVRRGEVYGLAGESGSGK
TSLVKALAGAIRPPLQIVGGSVNYNFGGKHIDIYDPAVDIRSLRWRHLSYIMQGSMSVLN
PVRKIRQSFYDFAFPHMNMGKREFWDTVERHLTKLQLDPAILMSYPHQLSGGMRQRTTIA
LATVCHPEFIIADEPTTALDVIVQRDVLRMIKEVQLQQGSSIIFVTHDMSVHATIADRIG
IVYGGRLVEEAPSLELFRAPKHPYTTHLISSLPRIGDDRPRDSLPGRPPNLANPPSGCPF
HPRCPLAVDKCKTDAPPLEGNHGESRVACWRAGEAEIA
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggaaatacgcgagcatccggtcgcacctgacgacgttctgacggtggatgacctcagg
gcttactacatggtagacggctacggcatttctcggcaggtgaaggccgttgacggggcc
acgctacgcgtccggcggggcgaggtttacgggctggccggtgaatccgggtcggggaag
acaagcctcgtgaaggcgcttgccggcgcgatccgcccgcctctccagatcgtggggggc
agtgtcaactacaacttcggtggcaagcacatcgacatctacgatccggccgtggacatc
aggtcgctgcgatggcgtcacctgagctacatcatgcaagggtcgatgtccgtgctcaac
ccggtaagaaagatacgccagtcattctatgacttcgcctttccgcatatgaacatggga
aaacgcgaattctgggacacagtcgagcggcacctgacgaagctgcaactcgatcccgcg
atcctcatgtcgtatccgcatcaattgtcgggcgggatgcgtcagcgaacgacgattgcg
ctcgccaccgtctgtcatccggaattcatcattgcggacgaaccgacaacggcccttgat
gtcatcgtgcagcgcgacgtgctgcgcatgatcaaggaggttcagcttcaacagggatcg
tccatcatcttcgtgacccatgacatgtctgtccatgcgaccatcgcggatcggatcggc
atcgtctacggagggcggctggtggaagaagccccatcgctggaactgttccgggcgcca
aagcatccctacacgacgcatttgatatccagccttccccggatcggggatgaccgcccg
cgcgacagcttgccgggtcggccgccgaatcttgcgaacccgccaagcggttgcccgttt
cacccgcgttgccccctggccgtggacaaatgcaagaccgatgcaccaccgctcgaaggg
aaccacggtgaaagtcgcgttgcctgctggagggccggggaggccgaaatcgcatga

DBGET integrated database retrieval system