KEGG   Litoreibacter sp. LN3S51: FPZ52_12990Help
Entry
FPZ52_12990       CDS       T06129                                 

Definition
(GenBank) hypothetical protein
Organism
lit  Litoreibacter sp. LN3S51
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Caps_synth Gly_transf_sug TcdA_TcdB
Motif
Other DBs
NCBI-ProteinID: QDY70604
UniProt: A0A5B8IXY4
LinkDB All DBs
Position
unnamed1:342747..343388
Genome map
AA seq 213 aa AA seqDB search
MNIPRRIHMLWLQGWQNAPDLARVCAEGWGKLNPNHDVVLHDASSVERQLARFPVPVAHL
PPQAAADIFRASLLNSEGGIWADASLVPIQPLDDWFGDMNAFGFSAVGGWQEGRAMENWF
LASTPGHAILSRFCAAAADYWTPERKTLIDVAWSGLDTGRVPVRQLKLSEAGVARSSSRS
EQLCATTRTPSLATCLSLLLVSVSVRLSNGSRS
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcccgcgtcgcattcacatgctctggttgcaaggttggcaaaatgcgccggac
ctagccagggtctgcgccgaaggatggggcaagctgaacccgaaccacgacgtcgtgctg
catgatgcgtccagcgtggaaaggcagcttgcccgttttccggtgccggtcgcgcatctt
ccaccccaggccgctgccgacatattccgcgcgtcactgctcaacagcgaaggcggtatt
tgggccgatgcgagccttgttcccatccaaccgcttgatgattggttcggtgatatgaac
gcctttggcttcagcgccgttggtggctggcaagaagggcgggcgatggaaaactggttt
ctagcctccacaccgggccatgcgatcctgtcccgcttttgcgccgctgcggcggactac
tggacgcccgagaggaaaacgctgatcgacgtggcgtggagcggtttggacacaggccgt
gttccggtccgtcagttgaaactgtcggaggctggggttgctcgatcctccagccgatcc
gaacaactatgtgcgaccacacggaccccgtcgctggcgacatgtctttccttacttctg
gtttcagtatctgttcggctatctaacggaagccgatcctga

DBGET integrated database retrieval system