KEGG   Litoreibacter sp. LN3S51: FPZ52_13110Help
Entry
FPZ52_13110       CDS       T06129                                 

Definition
(GenBank) NAD-dependent succinate-semialdehyde dehydrogenase
  KO
K00135  succinate-semialdehyde dehydrogenase / glutarate-semialdehyde dehydrogenase [EC:1.2.1.16 1.2.1.79 1.2.1.20]
Organism
lit  Litoreibacter sp. LN3S51
Pathway
lit00250  Alanine, aspartate and glutamate metabolism
lit00310  Lysine degradation
lit00350  Tyrosine metabolism
lit00650  Butanoate metabolism
lit00760  Nicotinate and nicotinamide metabolism
lit01100  Metabolic pathways
lit01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lit00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    FPZ52_13110
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    FPZ52_13110
   00310 Lysine degradation
    FPZ52_13110
   00350 Tyrosine metabolism
    FPZ52_13110
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    FPZ52_13110
Enzymes [BR:lit01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.16  succinate-semialdehyde dehydrogenase [NAD(P)+]
     FPZ52_13110
    1.2.1.20  glutarate-semialdehyde dehydrogenase
     FPZ52_13110
    1.2.1.79  succinate-semialdehyde dehydrogenase (NADP+)
     FPZ52_13110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: QDY70620
UniProt: A0A5B8J8M4
LinkDB All DBs
Position
unnamed1:complement(364398..365834)
Genome map
AA seq 478 aa AA seqDB search
MYSDYGLFINGTWRPATDGATFDVLSPVNEKPLGAAPAANPADTEHAIAAAETALPQWSA
TGAFDRADALHRIADEMRANREKAVRMITMETGKPLAQSEREWGLAIDQFRWYAEEARRI
YGRIIESRVPNGRFEVYRGPVGIAAAFTAWNFPAALVARKVAPALAAGCAVLIRPSSQTP
GTAMVIVDCLRAGGLPDGTVGLVVGSTANTYGPIMASKAVRKVSLTGSTRVGQQMIRDAA
DTVKKVSMELGGNSPCIIHDDADLESALDILVPTKFANCGQVCVSPDRFFVHESVHDRFV
DGFAERAAALKLGDGIDPATQMGPLIKRSRLEEIEAIIADATQAGATVATGGTRPAQFNA
GHFHNPTVLSDVTDDMRAFAEENFGPIAAISRFGSEDEVLDRANASDMGLAAYTFTRSPD
RARRAVAELKAGMVGINSPAIAASEAPFGGTKYSGMGREGGSEGIEDYLDTKLAQIVW
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgtatagcgactacggactgttcataaatggcacctggcgcccggcgaccgacggcgcg
acattcgacgtcctcagcccggtcaacgaaaagccgctaggtgccgctccggccgcgaac
ccggcggataccgaacacgcgattgccgccgccgaaacggccttgccccaatggtctgcg
acaggcgcgttcgaccgtgctgacgccttgcaccgcatcgccgacgagatgcgcgcgaac
cgcgaaaaggcggtgcggatgatcaccatggaaacgggaaaacccctggcccagtcggaa
cgcgaatgggggctcgcgatcgaccagttccgctggtatgccgaagaagcgcgacgcatc
tatggccggatcatcgaaagccgtgtccccaatggccgcttcgaggtgtatcgcggcccc
gtcggtattgccgctgcgttcacggcatggaatttccccgccgcgctcgtagcccgcaag
gtggcacccgcgctcgccgcggggtgtgccgtcctgatacgtccgtccagccaaaccccc
ggaaccgcgatggtaatcgtcgattgcttgcgcgcaggcgggcttcccgatggtacggta
ggcttggtggtcggcagcacggccaacacctatgggccgatcatggcatccaaggccgtg
cgaaaggtctcgctgacgggatcgacgcgtgtcgggcagcagatgatccgcgatgcggcc
gatacggttaagaaggtgtccatggaactgggcggcaattcgccctgcatcattcacgat
gacgccgatctggaaagcgcgctcgatatccttgtgccaacgaagttcgccaattgcggg
caggtttgcgtcagccccgaccggttcttcgtgcatgaaagcgttcacgatcggttcgtg
gacggtttcgccgaacgggcggctgcgctcaagctcggcgacggcatcgacccggcgacc
cagatgggtcccttgatcaagcgcagtcgactcgaagagatcgaggccatcatcgccgac
gcgacacaggcgggcgcgacggttgcaacaggcggaacccgcccggcgcaattcaatgcg
ggccacttccacaatcccacggtcctgtcggatgtcaccgacgacatgcgcgcctttgcc
gaagaaaacttcgggccgatcgccgccatcagccgcttcgggtcggaagacgaagtgctt
gatagggcgaacgcctccgatatggggctggctgcctataccttcacgcgcagcccggac
cgcgcccggcgggccgtcgccgagctgaaggcaggcatggtcgggatcaacagccccgcc
attgccgcctccgaggccccgttcggtggcacgaaatattccggcatgggacgcgaaggt
ggcagcgaagggatcgaggactatctcgacaccaagctcgcccagatcgtctggtga

DBGET integrated database retrieval system