KEGG   Litoreibacter sp. LN3S51: FPZ52_13160Help
Entry
FPZ52_13160       CDS       T06129                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
lit  Litoreibacter sp. LN3S51
Pathway
lit02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:lit00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    FPZ52_13160
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lit02000]
    FPZ52_13160
Transporters [BR:lit02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    FPZ52_13160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 oligo_HPY SMC_N DUF87 AAA_22 AAA_16
Motif
Other DBs
NCBI-ProteinID: QDY70630
UniProt: A0A5B8J8N6
LinkDB All DBs
Position
unnamed1:375730..376566
Genome map
AA seq 278 aa AA seqDB search
MTRPLLDIRNLRVSFPTPNGRVEVVKGIDLTLGRERLGIVGESGSGKSMTGRAILRLIRK
PGRMTADRMAFDGIDLLPLPDRRMRDIRGARISMIMQDPKFSLNPVITIGAQIAEALRAH
ERLPRRQEQARVIEMLDAVRINDPERVARMYPHQVSGGMGQRVMIAMMLIPRPDLLIADE
PTSALDVSVQAQVLDLIDELVREDGMGLILISHDLNLVVRYCDRIMVMNAGQVVEECAAS
ELHNATHPYTRGLLASVPRMDEDRDELPVLDRTAWSGT
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgacgcggccgcttctggatattcgcaaccttcgtgtcagcttccctacacccaacggc
cgcgtagaggttgtcaagggcatcgacctgacacttggacgggaacggcttgggatcgtg
ggcgaaagcggatcaggcaagtccatgaccggtcgcgcgatcctgcggctgatccgcaaa
ccgggccgcatgaccgcggacaggatggcattcgatggaatcgatctgctgcccctgccc
gatcgcaggatgcgcgacattcggggtgcgcggatttcaatgatcatgcaggatccgaag
ttttcgcttaatcccgtgatcacaattggcgcgcagattgccgaagccttgagagcccat
gaacgcctgccgcgcaggcaggaacaggcgcgcgtgatcgagatgctggacgcggtacgg
atcaacgacccggaacgcgtggcgcgcatgtatccgcatcaggtgtccggcggcatggga
cagcgcgtgatgatcgcgatgatgctgatcccacgccctgatctactgattgcggacgag
cccaccagcgcactcgacgtctctgtgcaggcccaagtgctggatttgatcgacgagttg
gtgcgcgaagacggcatggggttgatcctgatcagccacgacctgaacctcgtcgtccgc
tattgcgacaggatcatggtgatgaatgcgggccaggtcgtggaggaatgcgccgcaagc
gaacttcacaacgccacccatccctatacgcgtggacttctggcgtctgtaccaagaatg
gacgaggaccgagacgagttgccggttctggatcgaaccgcatggagcggcacatga

DBGET integrated database retrieval system