KEGG   Litoreibacter sp. LN3S51: FPZ52_15435Help
Entry
FPZ52_15435       CDS       T06129                                 

Definition
(GenBank) NAD(P)-dependent alcohol dehydrogenase
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
lit  Litoreibacter sp. LN3S51
Pathway
lit00040  Pentose and glucuronate interconversions
lit01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lit00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    FPZ52_15435
Enzymes [BR:lit01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     FPZ52_15435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: QDY71103
LinkDB All DBs
Position
unnamed3:88062..89099
Genome map
AA seq 345 aa AA seqDB search
MKALVLEEKGKLSLRDFDIPGTMGPRDVRIKTHTVGICGSDVHYYTHGKIGHFVVKEPMV
LGHEAAGTVVACGDEVSDLKLGDRVCMEPGIPDTDSRASKLGIYNVDPAVRFWATPPVHG
CLTSEVIHPASFTYKLPESVSFAEGAMVEPFAIGMQAALRARIQPGDIGVVSGAGPIGMM
VALAALAGGCAKVIVTDLAQPKLDIIGAYDGIDTVNIRDKSAAQSVAEATDGWGADIVFE
CSGAAPAVLGMHELARPGGAIVLVGMPVDPVPVDIVGLQAKELRLETVFRYANVYDRAIA
LMASGKVDLRPLVSGTIPFEDSIAGFDRAVEARETDVKLQIRMPD
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctctggttctggaagaaaagggcaagctgtccctgcgtgatttcgatattccc
ggcaccatggggccgcgtgatgtgcgcatcaagacgcatacggttgggatctgcgggtcg
gatgttcattactatacacatggcaaaatcgggcatttcgtcgtgaaagagccgatggtg
cttggacacgaggctgcaggtacggtcgtcgcttgcggtgacgaagtgtcggatcttaag
ctcggagatcgcgtttgcatggagccaggaattcccgatacggacagccgggccagcaag
ctcgggatctacaacgtcgaccccgccgtgcgcttttgggcgaccccgccagtgcatggc
tgccttacgtcggaggtgatccatcccgcgagcttcacctacaagcttccggagagcgtc
agctttgccgagggggccatggtggaaccttttgcgatcggtatgcaagcagcccttcgc
gcccggattcaaccgggtgatattggtgtcgtttcgggcgcaggccccatcggcatgatg
gtcgctctggcggctttggccggtggttgtgcgaaggtaatcgtgacggacttggcgcaa
cccaagctggacatcatcggtgcgtatgacgggatcgatacagtcaacatccgcgacaag
agcgcagcacagtctgtcgcggaagcaacggatggctggggtgcagatatcgtgttcgaa
tgttcgggcgctgcaccggcggtacttggaatgcatgagttggcccgccccggaggtgcg
atcgtgcttgtagggatgcccgtcgatcccgttccggtggatatcgttggacttcaggcg
aaggaattgcggctggagacggtattccgctacgccaatgtctatgaccgggcgattgcg
ctgatggcgtccggaaaggtggatcttaggccccttgtttccggaactattccgttcgag
gacagcattgccgggttcgaccgggccgtggaagcgcgcgaaacggatgtgaagcttcaa
atccggatgcccgactag

DBGET integrated database retrieval system