KEGG   Listeria ivanovii subsp. ivanovii PAM 55: LIV_0793Help
Entry
LIV_0793          CDS       T01623                                 

Gene name
ddlA
Definition
(GenBank) Putative D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
liv  Listeria ivanovii subsp. ivanovii PAM 55
Pathway
liv00473  D-Alanine metabolism
liv00550  Peptidoglycan biosynthesis
liv01100  Metabolic pathways
liv01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:liv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    LIV_0793 (ddlA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LIV_0793 (ddlA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    LIV_0793 (ddlA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:liv01011]
    LIV_0793 (ddlA)
Enzymes [BR:liv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     LIV_0793 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:liv01011]
 Precursor biosynthesis
  Amino acid ligase
   LIV_0793 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: CBW85279
UniProt: G2ZDF6
LinkDB All DBs
Position
850403..851515
Genome map
AA seq 370 aa AA seqDB search
MKTKLILLYGGKSAEHEVSLQTAFSVINALDLNKFEAQPIYITNEGEWVQGPLLSGKLDF
VEQLRFAAADKVELALAETEKSAGELISPTVLEADGQETVVFPLLHGPNGEDGTVQGLFE
VLNIPYVGNGVLASSAAMDKIVMKKIFADAAIPQVPAVAVRLIDWKNFQDEMVTEMEEVL
EYPVFVKPANLGSSVGISKATNKQELTEAMTEAFLYDRRVVVEQGVVAREIEMGVLGNDT
PICSVPGEILPEGAVATFYDYKAKYQDNNTTLIIPTEVEPEILAQMKEYAIQAFLGLDAS
GLVRADFFLTDDNQLFLNEVNTMPGFTPYSMYPLLWQETGLPYPALIERLVDLAKERHAA
KNALKYKLED
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccaagttaattttattatacggtggaaaatccgcagaacatgaggtttcttta
caaacagcattttctgtaattaatgcactagatttaaataaatttgaagcacagccaata
tatattacaaatgaaggggaatgggtacaaggcccactcctttctggaaaattagacttt
gtggagcaattgcgttttgcggcagctgataaggtggaacttgctttagcagaaacggag
aagtcggcgggagaacttattagcccaactgttttagaagcagatggacaagagactgtt
gtgttcccattgttacatggaccgaacggagaagacggtacagtacaaggattatttgaa
gtattaaatatcccttatgttggtaatggtgtgcttgcttcatcggcggcaatggataaa
atcgttatgaaaaagatctttgcagatgcagcgattcctcaagttccagcagtagctgtt
cgtttgattgactggaagaactttcaagatgaaatggttaccgaaatggaagaagtgcta
gaatacccagtttttgttaaaccagcaaatcttggttctagtgttggtattagcaaggcg
accaataaacaagagctaacggaagcaatgactgaagcatttttatatgatcgtcgtgta
gtagtagagcaaggcgtagttgcccgtgaaatcgaaatgggcgttcttggaaatgatacg
ccaatttgttccgtgccaggtgaaattttgccagaaggagccgtggcaacattttatgat
tataaagcgaagtatcaagacaataatacgacgcttattatcccgacagaagtagaacca
gaaattctagcacaaatgaaagaatatgctattcaagcgttcttaggtttagatgctagt
ggacttgttcgcgctgatttctttttaacagatgataatcaattattcttaaatgaagtg
aacacgatgccagggtttacaccttatagtatgtatccacttttatggcaagaaaccgga
ttaccttatccggccctaattgaacgactagttgatctagcaaaagaacgtcacgcagca
aaaaatgcacttaaatataaattagaagactaa

DBGET integrated database retrieval system