KEGG   Listeria ivanovii subsp. ivanovii PAM 55: LIV_2583Help
Entry
LIV_2583          CDS       T01623                                 

Definition
(GenBank) Putative polyol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
liv  Listeria ivanovii subsp. ivanovii PAM 55
Pathway
liv00040  Pentose and glucuronate interconversions
liv00051  Fructose and mannose metabolism
liv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:liv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LIV_2583
   00051 Fructose and mannose metabolism
    LIV_2583
Enzymes [BR:liv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     LIV_2583
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 FAD_binding_3 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: CBW87083
UniProt: G2ZCA4
LinkDB All DBs
Position
complement(2720682..2721713)
Genome map
AA seq 343 aa AA seqDB search
MKAVVKTNPGYDQMELKDVEEPQAYGDKVKIKVAFTGICGSDIHTFKGEYKNPTTPVTLG
HEFSGVVVEVGPDVTSIKVGDRVTSETTFETCEECIYCKERDYNLCSNRRGIGTQANGSF
AEFVLSREESCHVLDERISLEAAALTEPLACCVHSALEKTTIRPDDTVLVFGPGPIGLLL
AQVVKAQGATVIMAGITKDSDRLLLARELGIDRIVDTLKEDLAEVVFGMTDGYGAERVFD
CSGAVPAVNQGLPLTKKKGDFVQVGLFAEKKNAIDEESIIQREIAYIGSRSQKPSSWILA
LDLLANGKINTDKMITKVYGLDDWREAFEAVMAGNEIKVLVKS
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagcagtagtaaaaacaaaccccggatatgaccaaatggagctaaaagatgtggaa
gaaccacaagcttacggcgacaaagtaaaaatcaaagtagccttcactgggatttgtgga
tcagatatccatacattcaaaggtgaatacaaaaatccaacaacaccagttacactcggg
catgaattctcaggtgtagtcgtagaagttggtccagatgtaactagtatcaaagtggga
gaccgcgtcacaagtgaaacaacttttgaaacttgcgaggaatgtatttattgtaaagaa
cgtgattacaatttatgtagcaatcgtcgcggcattggtacacaagcaaatggtagtttt
gcagaatttgttttatctcgcgaggaaagttgtcacgtactagacgagcggatttcactt
gaagcggcagcacttacagaaccacttgcatgctgtgttcactctgcacttgaaaaaaca
acgattcgcccagatgatacagtacttgttttcggaccaggaccaatcggattattactt
gctcaagtagtgaaagcgcaaggagctacggtgattatggcaggaattaccaaagatagt
gaccgtttactcctagcaagagaactaggaatagaccgaattgtcgataccttaaaagaa
gacttggctgaagttgtgtttggcatgacagatggttacggagctgaacgagtatttgat
tgttctggcgcagtaccagcagtaaatcaaggattaccactaacgaagaaaaaaggcgat
tttgttcaagtaggactttttgctgaaaagaaaaatgcgattgatgaagagtcaattatt
caacgtgagattgcttatatcggcagtcgctcacaaaaaccttcttcatggattttagca
ctggacttactcgctaatggcaaaatcaatacagacaaaatgattactaaagtttatgga
ttagatgactggcgcgaggcttttgaggcagttatggcaggaaatgaaattaaagtatta
gtgaaatcttaa

DBGET integrated database retrieval system