KEGG   Listeria ivanovii subsp. ivanovii PAM 55: LIV_2670Help
Entry
LIV_2670          CDS       T01623                                 

Gene name
cydD
Definition
(GenBank) Putative ABC transporter (ATP-binding protein) required for expression of cytochrome BD
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
liv  Listeria ivanovii subsp. ivanovii PAM 55
Pathway
liv02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:liv00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    LIV_2670 (cydD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:liv02000]
    LIV_2670 (cydD)
Transporters [BR:liv02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    LIV_2670 (cydD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_membrane AAA_21 AAA_29 SMC_N RsgA_GTPase AAA_24 MMR_HSR1 DUF815 AAA_16 AAA_22
Motif
Other DBs
NCBI-ProteinID: CBW87172
UniProt: G2Z981
LinkDB All DBs
Position
complement(2806974..2808713)
Genome map
AA seq 579 aa AA seqDB search
MRKSSWIIPYIKENRGLFLLVIFLGTLTFASAGALMFTSGHLISKSSLMPESIMAVYVAT
VGVRAFGIMRSVSRYVERLMSHSLVLRILEKMRVRLYRLLEPQALLLKSRYKTGDILGLL
AGDIEHLQNFYLTTMLPAIVSLVLYAGVVIALGVFSVPFAMLFVFLIGMLVLVLPWVSLL
YARGKNAYLKQGRNGLYQKFTDAVFGISDWKFSGREKTFITNYEKDEAAMLHTENKQFHF
VNWRDFFSQLVVGFMVIAMVYWSTAESRDGAFSGTMIAAFVLAIMALAEAFVPVSSAISD
KSLYQDSLSRLDKVEDPTLPNFDEEMKEMERIDTQEVILKAENLTFAYDEKSPKILNGFD
FTLQQGEKVAIIGRSGTGKSTFLKLVQGALLPTDGKLTMNGVEVEKLRPEIPKLTSMLNQ
KAHLFSTSVLNNIRLGNQGASDEEVYEAAKKVQLHDFIMRMPDGYHTQMSEMGERFSGGE
RGRIALARILLQNTPIVILDEPTVGLDPITERDLLATIFETLADKSLIWVTHHLVGAEKM
DRVLFLEEGKTLMEGPHAELMAAEPRYKRLYQLDRPIEL
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgcggaaaagtagctggattatcccatatataaaagaaaaccgcggcttgttcttgctt
gttatcttccttggaacgcttacttttgcttctgctggggcgctaatgtttacttcaggt
catttgatttctaaatcgtccctaatgccagaatcgataatggcagtatatgttgcaaca
gttggtgtgcgcgcattcggaattatgcgttcggtatcacgctacgtagaacgacttatg
agccattctctagtactgcgaattctagaaaaaatgcgggtgcgtttataccgcttacta
gagccgcaagctttgttactgaaatcgcgctataaaacgggcgatatcttgggactgctt
gctggggacattgagcatttgcaaaacttctatcttacaacgatgctaccggcaattgta
agtttagtcctttatgcaggggttgttatcgcactaggtgtattttcggtaccatttgcg
atgctatttgttttcttaattgggatgttggtactcgttttaccatgggtttccctttta
tatgctcgcgggaaaaatgcttatttaaaacaaggacgaaatggtctttatcaaaagttt
acggatgctgtttttggaattagcgactggaaatttagtggtcgggagaaaacctttatt
actaactatgaaaaagacgaagcggctatgcttcatacagaaaataagcaattccatttt
gttaactggcgcgatttctttagtcagttggtcgttggttttatggtcattgcgatggtt
tactggagcacggctgagtcacgtgatggagcattttctggcacgatgattgctgcattt
gtgttagcaattatggcacttgctgaagcgtttgtaccagtttctagcgccattagtgac
aaatcactataccaagactcgctttctcgcttagataaagtggaagatccaacactgcca
aattttgatgaagaaatgaaagaaatggagcgaatcgatacacaggaagtcattttaaaa
gctgaaaacttaacttttgcttatgacgaaaagtctccgaaaatcttgaatggctttgat
tttactttgcaacaaggtgaaaaagtagccattatcggtcgaagtggaacggggaaatca
acttttcttaagttagtccaaggcgcgcttcttcctactgatggaaaattgacgatgaat
ggggttgaagtagaaaaacttagaccagagattcctaaacttacatcgatgctaaatcaa
aaagcacatctttttagtacgagtgtgttaaataatattcgattaggaaatcaaggtgct
agtgatgaggaagtttacgaagcagctaagaaagtccaattgcatgattttattatgcgt
atgccagatggttatcatacacaaatgagtgagatgggtgaacgtttttcaggtggggaa
cgtggacgaattgcgctagcacgaattttacttcaaaatacgccgattgttattttagat
gagccaactgttgggcttgatccgataacggaacgagatttgttagctacgatttttgaa
actttagcggataaatcattaatttgggtaacgcatcacttagttggagctgaaaaaatg
gatcgcgtgttatttttagaagaaggaaaaacgttgatggaaggtccgcatgctgaatta
atggcagctgaaccacgatacaaacgactttatcaactagaccgaccaatcgaattataa

DBGET integrated database retrieval system