KEGG   Listeria ivanovii WSLC3009: AX25_09655Help
Entry
AX25_09655        CDS       T03045                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
liw  Listeria ivanovii WSLC3009
Brite
KEGG Orthology (KO) [BR:liw00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:liw01001]
    AX25_09655
Enzymes [BR:liw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AX25_09655
Protein kinases [BR:liw01001]
 Serine/threonine kinases: Other
  Bacterial family
   AX25_09655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr Haspin_kinase APH Kinase-like Kdo RIO1 Seadorna_VP7 LPD29
Motif
Other DBs
NCBI-ProteinID: AHI56331
LinkDB All DBs
Position
complement(1947489..1949456)
Genome map
AA seq 655 aa AA seqDB search
MMIGKRLNDRYKILHAIGGGGMANVYLAHDIILDRDVAVKILRIDLADESNLIRRFQREA
QSATSLVHPNIVSVYDVGEENDLHYIVMEHVDGMDLKQYIHENHPISYEKAVDIMLQIVS
AVAVAHQHHIIHRDLKPQNILIDHDGVVKITDFGIAMALSETSITQTNSLLGSVHYLSPE
QARGGMATQKSDIYSLGIVLYELLTGKVPFDGESAVSIAIKHLQADIPSARTQNPEIPQS
LENIIIKATAKDPFLRYQNAEEMEKDLQTCLNKDRLNEPKYVFKADDGDTKTIPIIATKE
AMQNLDNTIVPEGKVAAEEVTEEDKKGKKKKKMSKKKKIAWIVFSVIIAFTIAILLLWML
GKGPEEIAVPDVSGKTEDQAIALLQKDGFVIGKTAEKNSDEVEEGKVINTDPDAGEMKEK
GTKVNLFVSIGSKKITMDDYTGRSYDDTKALLEEQGFKNISSEEAYSSEVDKGMIISQTP
SAGTNVVAKSTDVKFVVSKGVEPITLKDLRGYTKTAVEDYASPLGLKVSSSEENSDSVEK
GQVISQSPSSGTTMNPGDTIEIVISAGPKEKAVKEVTKTFNISYTPSDEENPEPQHIQIY
IQDKDHSMTSAYREMNISQNTSVEVTFQIEEGTSGGYKIISDDKVIDEGTVPYPN
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgatgattggtaaacgtctaaatgatcgatataaaatcttacatgctataggcggcggt
ggaatggccaatgtttatcttgctcatgatattatcctagaccgtgacgttgctgtaaag
attttacgcattgatttagcagatgaaagtaatcttatacgccgttttcaacgagaagcg
caatctgcaacaagtttagttcatcctaatatagtcagtgtctatgatgttggtgaagaa
aatgacttgcactatatcgttatggagcatgtcgatggaatggacttaaaacaatacatc
cacgaaaaccacccaattagctacgaaaaagcagtcgatattatgctgcaaatcgtttcc
gcagtagctgttgcgcatcaacaccatattattcaccgcgatttgaaaccgcaaaatatc
ttaattgaccatgatggtgtcgtgaagattactgattttgggattgcgatggcgctttct
gaaacctctattacccaaacgaattctcttcttggctctgtccactacttatcaccagaa
caagctcgtggcgggatggcaacgcaaaaatcagatatttattcacttggaatcgtttta
tacgaattacttacaggaaaagtaccgtttgacggagaatcagctgtgtccattgcgatt
aagcatttacaagcagatattccttccgcaagaacacaaaatccagaaatccctcaaagc
ctagaaaatattatcattaaagcaaccgcaaaagatccttttctgcgttaccaaaatgca
gaagaaatggaaaaagacttacaaacttgcttaaataaagatcgtcttaatgagccaaaa
tacgttttcaaagcagatgatggcgatacaaaaaccatcccaatcattgcaacaaaagaa
gcaatgcaaaatttggataataccattgtccctgaaggaaaagtggccgcagaagaagta
acggaagaagataaaaaaggcaagaaaaagaaaaaaatgagtaagaaaaagaaaattgct
tggattgttttttcagtaattatcgcctttactatcgctatcttactactttggatgctt
ggtaaaggtccagaagaaattgctgtacctgatgtttcagggaaaacggaagaccaagcc
attgccctacttcaaaaagatggttttgtcatcgggaaaaccgctgaaaaaaatagcgat
gaagtagaagagggaaaagtgattaatacagatcctgatgctggggagatgaaggaaaaa
ggaaccaaagtaaacctatttgtaagcattggctctaaaaaaatcacgatggatgattat
actggtcgaagttatgatgacacaaaagcattactagaagaacaaggatttaaaaatatt
tcgtccgaagaggcttatagttctgaagtagataaaggaatgattattagccaaacgccc
tcagcaggaaccaatgtcgtagcgaaatcaacggatgtaaaatttgtcgtaagtaaaggt
gttgagccaattaccttgaaagaccttcgcggatatacgaaaacagccgtagaagattat
gcgtcacccctaggacttaaagtatccagctcggaagaaaactctgattcagttgaaaaa
ggccaagttatttcacagtctccttcatctggaactacgatgaatccaggcgatacgatt
gaaatagttatctctgccgggccgaaagaaaaagcagttaaagaagtaacaaaaacattt
aatatttcctatacacctagtgatgaagaaaatccagagccacaacatattcaaatctat
attcaagataaggatcatagtatgacaagtgcttaccgtgaaatgaatattagccaaaat
acatcggtagaagtcactttccaaatagaagaaggtacgagcggtggctataaaattatt
agtgatgataaagtaatcgacgaaggtacggttccatatccaaactaa

DBGET integrated database retrieval system