KEGG   Listeria ivanovii WSLC3009: AX25_12120Help
Entry
AX25_12120        CDS       T03045                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
liw  Listeria ivanovii WSLC3009
Pathway
liw00250  Alanine, aspartate and glutamate metabolism
liw00410  beta-Alanine metabolism
liw00430  Taurine and hypotaurine metabolism
liw00650  Butanoate metabolism
liw01100  Metabolic pathways
liw01110  Biosynthesis of secondary metabolites
liw01120  Microbial metabolism in diverse environments
liw02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:liw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AX25_12120
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AX25_12120
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AX25_12120
   00430 Taurine and hypotaurine metabolism
    AX25_12120
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AX25_12120
Enzymes [BR:liw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AX25_12120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: AHI56799
LinkDB All DBs
Position
2458743..2460137
Genome map
AA seq 464 aa AA seqDB search
MLYSKENQESYLEPIFGSSAEDCDIPKYTLGKEPLEPRIAYRLVKDELLDEGSARQNLAT
FCQTYMEDEATKLMSETLEKNAIDKSEYPRTAELENRCVNIIADLWHAPKEQKFMGTSTI
GSSEACMLGGMAMKFAWRNRAEKLGLDIHAKKPNLVISSGYQVCWEKFCVYWDIDMRVVP
MDRDHMQLNTDQVLDYIDEYTIGVVGILGITYTGRYDDIYALNEKIEQYNSQTDYKVYIH
VDAASGGFFTPFVEPDIIWDFRLKNVISINTSGHKYGLVYPGIGWVLWKDESYLPKELIF
KVSYLGGEMPTMQINFSRSASHIIGQYYNFLRYGFEGYRTIHQKTSDVAQYLANAVEATG
YFDIYNDGSHLPIVCYKLKEDANVDWTLYDLADRLQMRGWQVPAYPLPKNLENIIIQRYV
CRADLGFNMAEEFIQDFNASIHELNNAHILFHNKQQSGVHGFTH
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgttatatagtaaagaaaatcaagaaagttatttagaacccatttttggatccagcgca
gaggattgtgatattccaaaatatactcttggaaaagaacctttagaacctcgtatcgct
tatcgattagtgaaagatgaactattagatgaaggatctgctcgtcaaaatttggctact
ttttgccaaacatatatggaagatgaagctaccaaattaatgtccgaaaccttagaaaaa
aatgccattgataaatcggagtatccacgaacagcggaacttgaaaatcgctgcgttaat
attattgcagatttatggcacgcaccaaaagaacaaaaattcatgggaacttctacaatt
ggctctagtgaagcttgtatgttaggtggaatggcgatgaaatttgcttggcgaaatcgt
gcagaaaagctaggcctagatattcatgcgaaaaaaccaaaccttgtcatttcttccggt
taccaagtttgttgggaaaaattctgtgtttactgggatattgacatgcgggtcgtgcca
atggatagagaccatatgcaactaaataccgaccaagtactagattatattgatgaatat
actatcggcgtcgtcggtatccttggtattacctacacaggacgttacgatgacatctac
gcccttaatgagaaaatcgaacaatacaacagccaaacagattacaaagtttacatccac
gttgatgcagcaagcggaggcttctttaccccatttgtggaaccggacatcatttgggac
ttccgtttaaaaaatgttatctctattaacacttctggacataaatatggattagtttat
cctggtatcggctgggtgctttggaaagatgaaagctatttgccaaaagaactcattttc
aaagttagttaccttggcggagaaatgccaacaatgcaaatcaatttctctaggagtgct
agccatattatcggccaatattataatttcctacgctatggctttgaaggctaccggacc
attcaccaaaaaacaagtgatgtagctcagtatctagcaaacgctgtagaagcaacaggc
tatttcgatatttataatgacggttcccatttaccaattgtctgctataaattaaaagag
gatgcaaacgttgattggacgctttatgatttagctgaccgtttgcaaatgcgcggatgg
caagtcccagcttatccactaccaaaaaatttagaaaacatcattattcaacgttatgtt
tgtcgcgctgatcttggtttcaatatggctgaagaatttatccaagatttcaatgcttcc
attcacgaactaaataacgcccacatccttttccataataaacagcaatccggtgttcat
ggcttcacgcactaa

DBGET integrated database retrieval system