KEGG   Listeria ivanovii WSLC3009: AX25_13830Help
Entry
AX25_13830        CDS       T03045                                 

Definition
(GenBank) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
liw  Listeria ivanovii WSLC3009
Pathway
liw00040  Pentose and glucuronate interconversions
liw00051  Fructose and mannose metabolism
liw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:liw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AX25_13830
   00051 Fructose and mannose metabolism
    AX25_13830
Enzymes [BR:liw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     AX25_13830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 FAD_binding_3 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AHI57094
LinkDB All DBs
Position
complement(2766856..2767887)
Genome map
AA seq 343 aa AA seqDB search
MKAVVKTNPGYDQMELKDVEEPQAYGDKVKIKVAFTGICGSDIHTFKGEYKNPTTPVTLG
HEFSGVVVEVGPDVTSIKVGDRVTSETTFETCEECIYCKERDYNLCSNRRGIGTQANGSF
AEFVLSREESCHVLDERISLEAAALTEPLACCVHSALEKTTIRPDDTVLVFGPGPIGLLL
AQVVKAQGATVIMAGITKDSDRLLLARELGIDRIVDTLKEDLAEVVFGMTDGYGAERVFD
CSGAVPAVNQGLPLTKKKGDFVQVGLFAEKKNAIDEESIIQREIAYIGSRSQKPSSWILA
LDLLANGKINTDKMITKVYGLDDWREAFEAVMAGNEIKVLVKS
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagcagtagtaaaaacaaaccccggatatgaccaaatggagctaaaagatgtggaa
gaaccacaagcttacggcgacaaagtaaaaatcaaagtagccttcactgggatttgtgga
tcagatatccatacattcaaaggtgaatacaaaaatccaacaacaccagttacactcggg
catgaattctcaggtgtagtcgtagaagttggtccagatgtaactagtatcaaagtggga
gaccgcgtcacaagtgaaacaacttttgaaacttgcgaggaatgtatttattgtaaagaa
cgtgattacaatttatgtagcaatcgtcgcggcattggtacacaagcaaatggtagtttt
gcagaatttgttttatctcgcgaggaaagttgtcacgtactagacgagcggatttcactt
gaagcggcagcacttacagaaccacttgcatgctgtgttcactctgcacttgaaaaaaca
acgattcgcccagatgatacagtacttgttttcggaccaggaccaatcggattattactt
gctcaagtagtgaaagcgcaaggagctacggtgattatggcaggaattaccaaagatagt
gaccgtttactcctagcaagagaactaggaatagaccgaattgtcgataccttaaaagaa
gacttggctgaagttgtgtttggcatgacagatggttacggagctgaacgagtatttgat
tgttctggcgcagtaccagcagtaaatcaaggattaccactaacgaagaaaaaaggcgat
tttgttcaagtaggactttttgctgaaaagaaaaatgcgattgatgaagagtcaattatt
caacgtgagattgcttatatcggcagtcgctcacaaaaaccttcttcatggattttagca
ctggacttactcgctaatggcaaaatcaatacagacaaaatgattactaaagtttatgga
ttagatgactggcgcgaggcttttgaggcagttatggcaggaaatgaaattaaagtatta
gtgaaatcttaa

DBGET integrated database retrieval system