KEGG   Lotus japonicus: Lj0g3v0111689.1Help
Entry
Lj0g3v0111689.1   CDS       T04348                                 

Gene name
Lj0g3v0111689.1
Definition
(Kazusa) -
  KO
K11426  [histone H3]-lysine4/36 N-trimethyltransferase SMYD [EC:2.1.1.354 2.1.1.357]
Organism
lja  Lotus japonicus
Pathway
lja00310  Lysine degradation
lja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    Lj0g3v0111689.1 (Lj0g3v0111689.1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lja03036]
    Lj0g3v0111689.1 (Lj0g3v0111689.1)
Enzymes [BR:lja01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     Lj0g3v0111689.1 (Lj0g3v0111689.1)
    2.1.1.357  [histone H3]-lysine36 N-dimethyltransferase
     Lj0g3v0111689.1 (Lj0g3v0111689.1)
Chromosome and associated proteins [BR:lja03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     Lj0g3v0111689.1 (Lj0g3v0111689.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
LinkDB All DBs
AA seq 302 aa AA seqDB search
MEMEMEMKCMEDIDIATDLTPTLSPLSFSLHNSHLHTHCSACFSPLPNPNPHSLFYCSPL
CSAAHSALRLSSADSSLLRTALRLLLHHRPSSTGRIAGLLSNRHLLTCPNLSPSHDDVSV
SDSVRAMAAAIAKQRGGREQDDAVLEDATVALCAVLTNAVEVHDSQGCALGIAVFEPAFS
WINHSCSPNACYRFTFKSLSSDEAKLRIAPFNSQQSMIDSEVCGGSSEFGKEWELGYGPR
LIVRSIKRINKGDEVTVAYTDLLQPKAMRQSELWSKYRFNCCCQRCSALPFTYVDHALQV
RL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggaaatggagatggagatgaaatgcatggaagacattgacatagcaactgacctaacc
ccaacactctcccctctctctttctctctccacaattcccatctccacactcactgctcc
gcatgtttctctcccctccccaatcccaatccccattccctcttttactgctcccctctc
tgctccgccgcacattccgctctccgcctctcctccgccgactcctctctcctccgcacc
gccctccgcctcctcctccaccaccgtccctcctccactggccggatcgccggactgctc
tctaaccgccacctgctgacgtgccctaacctctctccctcccacgatgacgtgtcggtc
tccgatagcgtcagggccatggccgccgcgattgcgaaacaacgcggcggccgcgaacag
gacgacgccgttctggaggacgccactgttgctctctgcgctgtgctaacgaacgccgtg
gaggtgcacgatagccaagggtgcgccctcgggattgcggttttcgaacctgcgttctct
tggatcaaccacagttgttcacccaatgcgtgttaccgcttcaccttcaagtccctttct
tctgatgaagcgaagcttcgcattgctccgttcaattctcaacaatcaatgatagatagt
gaggtttgtggtggcagtagtgaatttggaaaagaatgggaactgggctatggtccaaga
ttgattgtgaggagtatcaagagaataaacaagggagatgaggtgactgtagcatatact
gacctcttgcaacctaaggcaatgaggcaatcagagttatggtcaaagtaccggtttaat
tgttgttgccaacgatgtagtgccctgcccttcacatatgtggatcatgcattgcaagta
agactttga

DBGET integrated database retrieval system