KEGG   Lotus japonicus: Lj0g3v0135089.1Help
Entry
Lj0g3v0135089.1   CDS       T04348                                 

Gene name
Lj0g3v0135089.1
Definition
(Kazusa) -
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
lja  Lotus japonicus
Pathway
lja00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:lja00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    Lj0g3v0135089.1 (Lj0g3v0135089.1)
Enzymes [BR:lja01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Lj0g3v0135089.1 (Lj0g3v0135089.1)
Chromosome and associated proteins [BR:lja03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     Lj0g3v0135089.1 (Lj0g3v0135089.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
LinkDB All DBs
AA seq 373 aa AA seqDB search
MGSRGRGNKPSKPLKESRTSNSLSDSMPAMKKNSELTHFGAIFNKLVKELKEPVVDFELP
DCFHKSKAMEYIHIKRNIYLTKKFKRRFDDDGIFCSCSSESPPVCGRDCHCGMLQSSCSS
GCNCGSLCLNKPFQSRPIKKMKLVKTEKCGSGIVADEDIKLGDFVVEYVGEVIDDKTCEE
RLWNMKHRGETNFYLCEINRDMVIDATYKGNKSRYINHSCCPNTEMQKWIVDGETRIGIF
ATRDIQKGEHLTYDYQFVQFGADQDCHCGAAGCRRKLGARPTKPKMSSDAALKLVAYQVC
QNGGLQIGSSRVDKSLCIHNCIGNIVMIKQLGNARFGHILRFDKYSRKHSILFEDGCVEI
YDMSKEDWELVRL
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggggtctcgggggaggggaaataagcctagtaagcctttgaaggaatcaagaacatct
aattctctatcagattccatgcctgccatgaaaaagaattctgagctgactcattttgga
gctatattcaacaagttggtgaaggagcttaaggagcctgttgttgattttgaacttcca
gattgttttcataagtcgaaggcaatggagtatattcatataaaacgcaatatatatctc
actaagaagttcaagagacggtttgatgatgatggcatattttgttcctgttcatctgaa
tctccacctgtatgtggtagagattgccactgtgggatgcttcaatctagttgctcctca
ggctgtaactgtgggagcttatgtcttaacaagccatttcagagtcgccctataaaaaag
atgaagttggttaagactgagaaatgtggttctggaattgtcgcggatgaagatatcaag
cttggggactttgttgttgagtatgttggagaagttattgatgacaaaacatgtgaagaa
aggctttggaacatgaaacatcgtggggaaacaaacttttacctatgtgaaatcaatcga
gatatggtgatagatgcaacatataagggaaacaagtcaagatatatcaatcatagctgc
tgccccaatactgagatgcagaaatggatagttgatggtgaaacacgaattggcatattt
gcaacgcgtgacatacaaaagggcgagcatctgacttatgattaccagtttgttcagttt
ggtgcagatcaagattgccattgtggtgctgctgggtgcaggcgtaagctaggtgctcga
cctaccaagcctaaaatgtcttcagatgctgcattaaaattagttgcatatcaggtttgt
cagaatggaggcttgcaaatcggaagttctcgtgttgacaaatcactgtgcatacacaat
tgcattggtaatattgttatgataaaacagctaggaaatgcgaggtttgggcatatttta
cggttcgataaatattcccgaaaacactcgatcctgtttgaggatggctgtgttgagatt
tatgatatgtcaaaagaagattgggaacttgtgagattgtga

DBGET integrated database retrieval system