KEGG   Lotus japonicus: Lj1g3v3244630.2Help
Entry
Lj1g3v3244630.2   CDS       T04348                                 

Gene name
Lj1g3v3244630.2
Definition
(Kazusa) -
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
lja  Lotus japonicus
Pathway
lja03030  DNA replication
lja03410  Base excision repair
lja03420  Nucleotide excision repair
lja03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:lja00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Lj1g3v3244630.2 (Lj1g3v3244630.2)
   03410 Base excision repair
    Lj1g3v3244630.2 (Lj1g3v3244630.2)
   03420 Nucleotide excision repair
    Lj1g3v3244630.2 (Lj1g3v3244630.2)
   03430 Mismatch repair
    Lj1g3v3244630.2 (Lj1g3v3244630.2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:lja03032]
    Lj1g3v3244630.2 (Lj1g3v3244630.2)
   03400 DNA repair and recombination proteins [BR:lja03400]
    Lj1g3v3244630.2 (Lj1g3v3244630.2)
Enzymes [BR:lja01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Lj1g3v3244630.2 (Lj1g3v3244630.2)
    6.5.1.6  DNA ligase (ATP or NAD+)
     Lj1g3v3244630.2 (Lj1g3v3244630.2)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     Lj1g3v3244630.2 (Lj1g3v3244630.2)
DNA replication proteins [BR:lja03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    Lj1g3v3244630.2 (Lj1g3v3244630.2)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     Lj1g3v3244630.2 (Lj1g3v3244630.2)
DNA repair and recombination proteins [BR:lja03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     Lj1g3v3244630.2 (Lj1g3v3244630.2)
   NER (nucleotide excision repair)
    Other NER factors
     Lj1g3v3244630.2 (Lj1g3v3244630.2)
   MMR (mismatch excision repair)
    Other MMR factors
     Lj1g3v3244630.2 (Lj1g3v3244630.2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_N DNA_ligase_A_M DRMBL RMMBL
Motif
LinkDB All DBs
AA seq 957 aa AA seqDB search
MLAEPALAPFVGADAVFLDTTYCHPKFVFPAQEESVDYVVNVVGECDGDDVLFLVATYVV
GKERILLELARRFNKKVLVDARKMEVLRVLGYGESSEFTEDGLETNIHVVGWNVLGETWP
YFRPDFVKMKDIMTERGYSKVVGFVPTGWTYEVKRSRFAVKSKDSCQIHLVPYSEHSNYE
ELREYVKFLKPKQVIPTVGLDVEKSDSKHANKMRKYFAGLVDETANKQEFLKGFRRGTSE
VGLKGEKDVSDVLEQGQIQEKEVKPSDADGETCAKDPTLLNDEEKEKIIQELSCCLPSWV
TRSQVLDLISISGSNIVEAVSNFYERETEFHDQVNSSQTSVSTSKCCSSDDTDSLPKSCL
NTNSTPLSVDIFPSQDSKLTKLRNTVPSRISPAKRKSSESKPNKKVKVKAKSESSGSKQS
TITRFFGKVTPEVPGGTHSDHAGSKLDESPKVEELLQSDVEKLYKDEIDQFMQIINGNES
LKRDAITIIKKAKGDVNKALDIYYCNSGHLGENEISAQEECKIDRPLEKKYVSQEMRVVH
DISVQKVLRNSVDATHLSLPPEKYNPKEHACWGDGQPAPYLHLARTFNLLEEEKGKIKAT
SMLCNMFRSLLALSPADVLPAVYLCTNKIAADHENVELNIGRSLVTTALEEACGTNRLKI
GEMYNKFGDLGDVAQECRQTQRLLAPPTPLLIKEVFSALRKMSVQTGNGSTVRKKGIIVH
LMRSCREKEMKFLVRTLVRNLRIGAMLRTVLPALAHAVVMNSRSTVDQEGTADNLKNKLQ
VLSVEVVEAYNILPSLDIIVPSLMSKGIDFSVSSLSLVPGIPIKPMLAKITNGIPQALKL
FQNKAFTCEYKYDGQRAHIHRLVDGSIRVFSRNGNESTSRFPDLIDIIKHSCKPVASTFI
IDAEVVGIDRKNGNRIMSFQELSSRGRGSKDTLVTAESIKVGICVFVFDIMFANGEQ
NT seq 2874 nt NT seq  +upstreamnt  +downstreamnt
atgttggctgagcctgcgcttgctccttttgttggtgccgatgctgtgtttttggacacc
acttactgtcacccgaagtttgtgtttcctgcacaagaggagtctgttgattatgttgtt
aatgttgtgggtgagtgtgacggtgatgatgtcttgtttctggttgctacttatgttgtt
gggaaggagaggattttgcttgagcttgcgcgaagatttaacaagaaggtgctggtggat
gctaggaaaatggaggttttgcgagttcttgggtatggggaaagtagtgaatttactgag
gatggattggagactaacattcatgttgttgggtggaatgtgttgggggaaacttggccc
tattttaggcccgactttgttaaaatgaaggatattatgaccgagagagggtactcaaag
gttgtgggttttgtgccaaccggatggacctatgaagtgaaacgcagtcggtttgctgtc
aagtccaaggattcgtgtcagattcatctcgttccttatagtgagcattcaaactatgaa
gagctcagggaatatgtaaagtttctgaaaccgaagcaggttattcccaccgtgggttta
gatgtcgagaaaagtgatagcaaacacgctaacaaaatgaggaagtattttgctggatta
gttgatgagacagccaacaagcaggagtttttaaaaggttttcgtcgtggcaccagtgaa
gtgggtttaaagggtgagaaggatgttagcgacgttctggaacaaggacagatccaggag
aaagaagtcaagccatctgatgcagatggggaaacgtgtgcaaaagatcctactttacta
aatgatgaagaaaaagagaaaatcattcaagaacttagttgttgtttgccctcatgggtc
actcgaagccaggtgttagatctgatcagtatctcagggagcaatattgttgaagctgtt
tctaatttctatgaacgtgaaactgaatttcatgatcaagtaaattctagtcaaacttca
gtttcaacatccaagtgctgctcatcagatgacactgattcacttccaaagtcatgcctt
aatacaaacagtactcccttaagtgttgacatttttcctagtcaagactctaaattaact
aaactgaggaatacagtaccaagtcgcatttcccctgccaaaagaaaaagtagtgaaagt
aagccaaacaagaaagtaaaagtcaaagcaaaatcagaatcaagtggttcaaagcagtca
actataacaagattcttcggcaaagtaacgcctgaggtgcctggtgggactcattctgat
catgctgggtcaaagcttgatgaaagtcctaaagttgaagagttgttgcaatctgatgtt
gaaaaattgtacaaggatgagattgatcagtttatgcaaataataaatggaaacgagtct
ttaaaaagagatgccatcactataattaaaaaggcaaaaggagatgtcaataaggcctta
gacatatattactgcaattctggccatcttggtgaaaatgaaatatcagctcaagaggag
tgcaaaatcgacagacctttagaaaagaagtatgtgtcacaggaaatgagagttgtacat
gatatttctgtgcagaaagtgttaagaaatagtgtagatgcaactcatttatctttacca
cctgagaaatacaaccctaaggaacatgcttgttggggagatggacagcctgcgccatat
ttacatcttgcacgaaccttcaatctgcttgaggaggagaaaggaaagataaaagctact
tcaatgttgtgcaatatgtttagaagtttgttggccttgtcaccagcagatgtgcttcct
gctgtgtatctatgtacaaacaaaattgctgcagaccatgaaaatgtggaactaaatatt
ggtagaagtttagtcactacagcacttgaagaagcatgtggaacaaatcgattgaaaata
ggggagatgtataacaaatttggtgaccttggtgatgtggctcaagagtgtcgtcaaaca
cagagattgcttgcaccacctacaccacttctaattaaggaagttttctctgcactacga
aagatgagtgtacaaacaggcaatggaagcacagttcggaagaaaggcatcatcgttcat
ctcatgcggtcttgccgggagaaggagatgaagtttcttgttcggacattggtcaggaac
ttacggattggggcaatgcttagaactgttttgcctgcattggctcatgctgttgttatg
aattctcgttctactgtggatcaagaaggaactgcagataatttgaagaataaacttcag
gtcctttctgtggaagttgttgaagcatataatattctgccaagtttggatatcatagtc
ccatctctcatgagcaaaggcattgatttttcggtttcaagtttatcactggttccagga
atccctattaagcctatgcttgcaaagatcaccaatggcattccccaagcattgaagcta
tttcaaaataaagcatttacatgtgaatataagtatgatggtcagcgagctcatatccac
agattagttgatggttcaattcgtgtcttttcaagaaatggaaatgaatcaacttctaga
tttcctgatctgattgacataattaagcactcctgcaagcctgttgcatcaactttcata
attgatgcagaggttgttggtattgatagaaaaaacggaaacagaattatgtcttttcag
gagctatcttcacgtgggagaggaagcaaagatactttagttactgcagagagcataaag
gttggcatttgcgtctttgtctttgatatcatgttcgcaaatggagagcagtaa

DBGET integrated database retrieval system