KEGG   Lotus japonicus: Lj2g3v1155540.1Help
Entry
Lj2g3v1155540.1   CDS       T04348                                 

Gene name
Lj2g3v1155540.1
Definition
(Kazusa) -
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lja  Lotus japonicus
Pathway
lja00010  Glycolysis / Gluconeogenesis
lja00020  Citrate cycle (TCA cycle)
lja00620  Pyruvate metabolism
lja01100  Metabolic pathways
lja01110  Biosynthesis of secondary metabolites
lja01200  Carbon metabolism
Module
lja_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lj2g3v1155540.1 (Lj2g3v1155540.1)
   00020 Citrate cycle (TCA cycle)
    Lj2g3v1155540.1 (Lj2g3v1155540.1)
   00620 Pyruvate metabolism
    Lj2g3v1155540.1 (Lj2g3v1155540.1)
Enzymes [BR:lja01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Lj2g3v1155540.1 (Lj2g3v1155540.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
LinkDB All DBs
AA seq 464 aa AA seqDB search
MASPFLPTTTSSVAATNSTTLSFSSALASRRVSFAASAPSKPRRRPSQSVQSKIREIFMP
ALSSTMTEGKIVSWVKSEGDVLSKGDSVVVVESDKADMDVETFYDGILAAIVVNEGQTAP
VGAPIGLLAETEEEVAEAKAKAASSANSAASSAPPVVESSSPAPAAKVVSDGPRKTVATP
YAKKLAKQHKVDIGSVVGTGPNGRITPADVEAAAGIKPAASNAAPAVVAAPAPAAAPPPI
PGSSVVPFTTMQSAVAKNMLESLSVPTFRVGYPVTTDALDALYAKVKLKGVTMTAILAKA
AAMALAQHPVVNASCKDGKSFTYNSSINIAVAVAINGGLITPVLQDADKLDLYLLSQKWK
ELVDKARSKQLQPHEYNSGTFTLSNLGMFGVDRFDAILPPGQGAIMAVGASKPTVLADKD
GFFSVKNKMLVNVTADHRIIYGADLAAFLQTFTKIIENPESLTL
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggcttccccatttctccccaccaccacctcctccgtcgccgccaccaattccaccacc
ctctccttctcctccgccctcgcctcacgccgcgtctccttcgcggcatcagcaccctcg
aaacctcgccggcggccttcccagtcagtccaatccaagatcagggagatcttcatgccg
gcgctcagctccaccatgacggagggcaaaatcgtctcctgggtgaaatccgagggcgac
gtcctctccaagggtgacagcgtcgtcgtcgtcgagtccgataaggccgacatggacgtc
gagacgttctacgatggaatcctcgccgccattgtcgtcaacgagggccagaccgccccc
gtcggcgcccctattggcctactcgctgagaccgaggaggaagtcgctgaggccaaagct
aaggctgccagttccgctaattccgccgcttcctccgccccgccagtggttgaatcttca
agtcctgccccggcggccaaggtggtttctgacgggccgcggaagacggtggcgacgccg
tacgccaagaagcttgccaagcagcacaaggtggatattggatcggtggtggggactggt
ccgaatggaaggattactccggctgatgtggaggctgctgctggaattaagccagctgcg
agcaatgcggctcccgctgtggtggctgctccagctccggcggctgccccgcctccaatt
cctgggtctagtgttgtccccttcacgacaatgcagtccgcagttgccaagaacatgttg
gagagtctctcggtgcctacattccgtgttgggtaccctgttaccactgatgcacttgat
gccctctatgcgaaggtgaagctgaagggtgtgacgatgacggcgattctagccaaggcc
gctgcgatggcactggctcaacatccagtggtgaatgcctcctgtaaagatgggaaaagc
tttacatataatagcagcattaacattgctgtagccgtggcaatcaatggtggtttgatt
actcctgttcttcaggatgctgataagttggacctctatcttttgtcccaaaaatggaaa
gagttagtggataaagctcgttctaagcaattgcagcctcacgagtataattcaggaaca
tttaccctttcaaatttgggaatgtttggagttgacaggtttgatgctatactacctcca
ggccagggggctatcatggctgttggagcatctaagcctactgttctggcagacaaggat
ggattcttcagtgtaaaaaacaaaatgctggtgaatgtaactgctgatcacagaataatc
tatggagcagacttggctgcattccttcagacgttcacaaaaattattgaaaatcctgaa
agcctaacattgtag

DBGET integrated database retrieval system