KEGG   Lotus japonicus: Lj2g3v1890940.1Help
Entry
Lj2g3v1890940.1   CDS       T04348                                 

Gene name
Lj2g3v1890940.1
Definition
(Kazusa) -
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
lja  Lotus japonicus
Pathway
lja00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:lja00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    Lj2g3v1890940.1 (Lj2g3v1890940.1)
Enzymes [BR:lja01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     Lj2g3v1890940.1 (Lj2g3v1890940.1)
Chromosome and associated proteins [BR:lja03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     Lj2g3v1890940.1 (Lj2g3v1890940.1)
   Polycomb group proteins
    PRC2-EZH2 complex
     Lj2g3v1890940.1 (Lj2g3v1890940.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET preSET_CXC TCR
Motif
LinkDB All DBs
AA seq 842 aa AA seqDB search
MQTKKVDDARPAVNDVLLVIDSLKKQVAAERVVSVKKKMEENRLKLVGVTDHLYKMSMER
RTGGIADMNGSLDLLSKRQKGATDMHNGVNASNGDRESNGYHEDGHGSTAVLLGYNVTTK
NAVRPIKLPEVKRLPPYTTWIFLDRNQRMTEDQSVVGRRRIYYDQNGGEALICSDSEEEI
IDDEEDKREFVESEDFILRMTIRELGISDIVLESLAQCFSRNSSEIKARYETLTNEGNAG
GGSKNGNAEENSQIDSSFVEKDLEAALDSFDNLFCRRCLVFDCRLHGCSQDLVFPAEKQP
SWNPPDTENAPCGPNCFRSVLKSERFAKVTSSTQADVEDKSSGGGLSRKKSSARRRTKCS
QSESASSNAKNISESSDSENGPGRDAVSASPSASSKTKSVGKSGIGKRNSKRVAERVLVG
MQKRQKKPVASDSDSISEAVGGSLNDMVTVPHAMRGEDSLRKEETVDENTFKQDLTDNGS
WKALEKGLLEKGMEIFGRNSCLLARNLLSGLKTCWDVFQYINCEEGKMSGPSGDATNSLV
EGYSKGNNEVRRRSRFLRRRGRVRRLKYTWKSAAYHSIRKRITERKDQPCRQYNPCGCQS
ACGKQCPCLLNGTCCEKYCGCPKSCKNRFRGCHCAKSQCRSRQCPCFAADRECDPDVCRN
CWVGCGDGTLGNPSQRGDNYECRNMKLLLKQQQRVLLGRSDISGWGAFLKNGVGKHEYLG
EYTGELISHREADKRGKIYDRENSSFLFNLNDQFVLDAYRKGDKLKFANHAPDPNCYAKV
IMVAGDHRVGIFAKERIGAGEELFYDYRYEPDRAPAWARKPEASGSKKEDGAPSSGRAKK
LA
NT seq 2529 nt NT seq  +upstreamnt  +downstreamnt
atgcagacaaagaaagtggacgacgcacgtcctgctgtgaacgatgtgttgctggttatt
gattctctcaagaaacaagttgcggctgaacgggttgtttcggttaagaaaaaaatggaa
gaaaatagactgaagctggttggtgtcacggaccatctctacaaaatgtcgatggagaga
aggaccggcggcattgccgatatgaatggaagtctggacctgctgtctaagaggcaaaag
ggtgcaactgatatgcacaatggcgttaatgcgagtaatggtgacagggagagcaatggt
tatcatgaagatggccacggctctacagcagttcttctaggatataatgttactacaaag
aatgctgttcgtcctatcaagttacctgaagtaaaaagattacctccttacactacgtgg
atttttctggacagaaatcaaagaatgacagaggatcaatcagttgtaggccggaggcga
atttattatgatcaaaatggtggagaagcactcatttgtagtgacagtgaagaggaaata
atagatgatgaagaggacaaaagagaatttgtagagtcagaagattttatacttcgcatg
actatcagagaacttggtatatctgatatagttctggagtcactggctcagtgtttttct
agaaacagtagtgaaattaaggcaagatatgaaactcttactaatgaaggcaatgctgga
gggggttccaagaatggaaatgctgaagagaattcccaaattgacagttcttttgtggaa
aaggatcttgaagcagctcttgactcttttgacaaccttttttgccgacgatgtctagtt
tttgattgcagattacatggatgttcgcaggaccttgtcttcccagctgagaaacaacct
tcatggaaccctcctgatactgaaaatgcaccatgtggtccaaattgcttccgatcggta
ctcaagtcagaaagattcgccaaagttacctcttctactcaggctgatgttgaagacaaa
agctctggtggtggtttatctagaaagaagtcttctgctagaaggcgtacaaaatgcagc
caaagtgagagtgcttcatctaatgcaaaaaacatatctgagagtagtgactcagagaat
ggtcctggacgggatgctgtttcagcttctccctcagcatcatctaaaactaaatccgtt
gggaaaagtggaattggtaagaggaacagtaagcgagtggcggaacgtgttctagttggc
atgcagaagaggcagaaaaagccagtggcttctgattctgattccatcagtgaagcagtt
ggaggttcattaaatgatatggttactgtcccacatgctatgaggggtgaagacagcttg
aggaaagaagagactgtggatgagaacacatttaaacaagatttaacagataatggatct
tggaaagctctcgagaaagggcttttagagaaaggaatggagatttttggtagaaacagc
tgcttactagccaggaatctcctaagtggtctaaagacgtgttgggatgttttccaatac
ataaattgtgaagaaggaaagatgtctggtcctagtggggatgctacaaattctcttgtg
gaaggctactccaagggcaataatgaagtaagacgaaggtcaagatttttacgtagaaga
gggagagtccgtcgtttgaagtatacctggaaatctgctgcttatcattcaatcaggaaa
aggattacagaaagaaaggaccagccctgccggcagtacaatccatgtggttgccaatca
gcttgtggaaagcagtgtccttgtcttctaaatggaacctgctgcgagaagtactgtgga
tgccccaagagttgcaagaataggtttcgtggctgtcattgtgcaaagagtcagtgccga
agtcgtcaatgcccatgctttgctgcagatagggaatgcgatcctgatgtttgtaggaat
tgttgggtcggttgtggcgatggtactcttgggaatcctagtcaaagaggggataattat
gaatgtaggaacatgaagcttcttctcaagcagcagcaaagggttcttcttggaaggtct
gatatatctggctggggagcctttttaaagaatggtgttggtaagcatgaatacctcgga
gagtatactggagaattaatttctcatagggaagccgataagcgaggaaagatatatgac
cgtgaaaactcatcttttctctttaatctgaatgaccagtttgttcttgatgcttaccga
aagggtgataaattgaagtttgcgaaccatgctcctgatccaaattgctatgccaaagtt
attatggttgctggagatcatagagtaggcattttcgccaaggaacggattggtgctggg
gaagaactgttttatgattatcgttatgagcccgatagagctcctgcatgggctcggaag
ccagaggcatctggatccaaaaaagaggacggtgctccttcaagtggtcgtgcaaagaag
cttgcttaa

DBGET integrated database retrieval system