KEGG   Lotus japonicus: Lj2g3v1904480.1Help
Entry
Lj2g3v1904480.1   CDS       T04348                                 

Gene name
Lj2g3v1904480.1
Definition
(Kazusa) -
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
lja  Lotus japonicus
Pathway
lja00562  Inositol phosphate metabolism
lja01100  Metabolic pathways
lja04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:lja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Lj2g3v1904480.1 (Lj2g3v1904480.1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    Lj2g3v1904480.1 (Lj2g3v1904480.1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lja01009]
    Lj2g3v1904480.1 (Lj2g3v1904480.1)
Enzymes [BR:lja01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     Lj2g3v1904480.1 (Lj2g3v1904480.1)
    3.1.3.48  protein-tyrosine-phosphatase
     Lj2g3v1904480.1 (Lj2g3v1904480.1)
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     Lj2g3v1904480.1 (Lj2g3v1904480.1)
Protein phosphatases and associated proteins [BR:lja01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    Lj2g3v1904480.1 (Lj2g3v1904480.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Y_phosphatase Y_phosphatase3 PTPlike_phytase CDKN3
Motif
LinkDB All DBs
AA seq 457 aa AA seqDB search
MEPTPPASNTQPSGMSSWARNLKSLGLGASQQNSQVENTGGMSAFARLTGGMGLGMPSSI
EAAPGSSGADQPNLIESFTKGLVDSSKTAVKAVQTKARHIVSQNKRRYQENGFDLDMTYI
TENIIAMGFPGGDLSSGLFGYIEGFYRNHMEEVIKFFETHHKGKYKVYNLCSERLYDGSL
FQGKVASFPFTDHNCPPIQLILSFCQSAYSWLKEDIQNVVVVHCKAGMGRTGLMICSLLM
FLKFFPTAEEAIDYFNQKRCIDGKALVIPSQIRYVKYFERTLTHFNGEVQPGRRCMLRGF
RLHKCPYWVRPSITISDHNGILFTTRKHPKTKDLMPEDFWINSPKKGIVVFAIPGEPGLA
ELIGDFKIHFHDRQGDFYCWLNRAMTENRKVLDGSDLDGFDKRKIPAPGFQVEIVMVDYT
GTLPTRTKANPASKGSDSNTSNVVAGARPTTNASESK
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggaacctactcctccagcttctaacactcaaccatctggcatgtcatcctgggcaaga
aatctgaaatcccttgggctcggggcgtcgcagcagaactcacaggttgaaaataccggt
ggcatgtcggcttttgctcgcttgacaggcgggatgggattaggaatgccctcctcgatt
gaggctgctccgggaagttcaggagctgatcagcctaatttaattgaatcgttcaccaaa
gggttggtggactcgtctaagaccgcagtaaaggcggtgcagaccaaagctcgccatatt
gtctctcaaaataaacgcagataccaggaaaatggatttgatttggatatgacatacatc
actgaaaatataattgctatggggtttccgggtggcgatcttagctctggactttttgga
tacattgagggtttctatcgcaatcacatggaagaagtaattaagtttttcgaaactcat
cataagggaaagtacaaagtatacaatctttgctcagagaggttgtatgatggatcacta
ttccagggaaaggttgcaagtttcccatttactgatcataattgccctcctattcaactt
atattgtcattttgtcaaagtgcatattcatggttgaaggaggatattcaaaatgtggtg
gttgttcattgtaaagctggtatggggaggacaggactgatgatttgtagccttcttatg
tttcttaaattcttcccaactgcggaggaagccattgattacttcaaccagaaacgatgt
attgatggaaaggctctagttatccctagtcagatcagatatgtcaaatactttgaacgg
actttaacacactttaatggagaggtccagcctggacgaaggtgcatgctaagagggttt
aggcttcacaaatgcccttattgggttagaccatccattacaatatctgatcataatgga
attcttttcacaactagaaagcatcccaaaacaaaggatttaatgccagaagatttctgg
ataaattcaccaaagaagggaatagtggtctttgcaataccaggagagcctggtctcgca
gagttgattggggacttcaaaattcattttcatgatcgacagggagatttctactgttgg
ctgaatagagcaatgacagaaaacagaaaagttttagatggctcggatcttgatggtttt
gacaagagaaagatccctgctccagggttccaggttgaaattgtgatggtagactatact
ggcaccctacctacaaggacaaaagccaatcctgcaagcaaaggatctgatagtaacact
agcaatgtcgtagccggtgcaaggcctacaactaatgcaagtgagagtaag

DBGET integrated database retrieval system