KEGG   Lotus japonicus: Lj2g3v2089780.3Help
Entry
Lj2g3v2089780.3   CDS       T04348                                 

Gene name
Lj2g3v2089780.3
Definition
(Kazusa) -
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
lja  Lotus japonicus
Pathway
lja00010  Glycolysis / Gluconeogenesis
lja00051  Fructose and mannose metabolism
lja00052  Galactose metabolism
lja00500  Starch and sucrose metabolism
lja00520  Amino sugar and nucleotide sugar metabolism
lja01100  Metabolic pathways
lja01110  Biosynthesis of secondary metabolites
lja01200  Carbon metabolism
Module
lja_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lja_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lj2g3v2089780.3 (Lj2g3v2089780.3)
   00051 Fructose and mannose metabolism
    Lj2g3v2089780.3 (Lj2g3v2089780.3)
   00052 Galactose metabolism
    Lj2g3v2089780.3 (Lj2g3v2089780.3)
   00500 Starch and sucrose metabolism
    Lj2g3v2089780.3 (Lj2g3v2089780.3)
   00520 Amino sugar and nucleotide sugar metabolism
    Lj2g3v2089780.3 (Lj2g3v2089780.3)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Lj2g3v2089780.3 (Lj2g3v2089780.3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lja04131]
    Lj2g3v2089780.3 (Lj2g3v2089780.3)
Enzymes [BR:lja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     Lj2g3v2089780.3 (Lj2g3v2089780.3)
Membrane trafficking [BR:lja04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    Lj2g3v2089780.3 (Lj2g3v2089780.3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
LinkDB All DBs
AA seq 498 aa AA seqDB search
MGRVVVGLAATVAVTACAVAAVVVGRRVRSRRKWRKVLNVLRELEEGCDTTVGRLRQVVD
AMAVEMHAGLASEGGSKLKMLLTYVDNLPNGTERGTYYALHLGGTNFRVSRVHLSGQSCS
ALEHEVERQPIPQPLMTSRGEELFDFIASSLKEFIAKEGDSSNISQDCRELGFTFSFPVK
QMSVSSGILIKWTKAFSIADMVGRDVAACLQEALTRKGLDVRVAVLVNDTVGTLALGHYH
DTDTVAAIIIGTGTNACYLERVDAIIKSQGLLTSSGRMVVNMEWGNFWSSHLPRTSYDID
LDAESPNPNDQGFEKMISGMYLGDIVRRVILRMLLESEMFGPISSKLSTPFILRTPLMAA
MHEDDSPDLGEVAKILNDVFEIPDVPLKARKIVVKVCDVVTRRAARLAAAGIVGILKKIG
RDGSGGIAGGRSRSDMKMRRTVVAIEGGMYSSYPLFREYLREALNEIMGEDIAKHVVLKV
TEDGSGIGAALLAASYSS
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggggagagtggtggtaggcttggcggcgactgtggctgtgacggcttgtgcggtggcg
gcggtggtggtggggagaagagtcaggagtaggaggaagtggaggaaagtgctcaatgtg
ctcagggagcttgaggaaggctgtgataccaccgttgggaggttgaggcaggtggtggat
gctatggcagtggagatgcacgctggtttggcttcagaaggtggttccaagctcaaaatg
cttctcacctacgttgataatctccctaatgggaccgagaggggaacgtattatgcactg
catcttgggggtaccaatttcagggtctcgcgggttcatttaagtggtcaatcttgctct
gccttggaacatgaagtagaacgacaacctattccccaacctctgatgactagtagaggc
gaggaactctttgattttattgcttcttcgttaaaggaattcattgctaaagaaggggat
agttccaatatttcacaggactgcagggaacttgggtttacattctcctttcctgtgaaa
caaatgtctgtttcatctggcatcttaatcaaatggacaaaagcgttttccattgcagat
atggtaggaagagatgttgcggcatgtttgcaggaagctttgactcgaaaaggcctagat
gtccgggtagctgtcttggttaatgacacagttggaacattagctcttggacattatcat
gacacagatactgttgctgcaattataattggtactggtaccaacgcctgctatctggag
cgagttgatgctatcatcaagtctcagggtcttcttacctcatcaggaagaatggttgtc
aatatggaatggggaaacttttggtcatctcacttaccaagaacatcatatgacattgat
ttagatgctgagagccctaatccaaatgatcagggtttcgagaaaatgatatcaggaatg
tatcttggtgacattgttaggagagttattctcaggatgttattggaatcggaaatgttt
ggacctatttcttccaagctctcaacccctttcatactgaggactccattaatggctgct
atgcatgaagatgattctcctgatttgggggaagttgcgaaaatccttaatgacgttttc
gagattccagatgttcctctgaaggcaaggaaaattgtggtgaaggtgtgtgatgtggtg
actcgaagagccgcccgattagcagccgccggcattgtcggtatcttgaagaagattggt
cgagacgggagtggtggcatcgcaggtggacggagtagaagtgacatgaaaatgagaaga
acagttgtggccattgaaggaggaatgtattctagctatccattgtttagggagtacttg
cgtgaagctttgaatgaaataatgggagaagatattgctaagcatgtagttctgaaagtg
accgaagatggatcgggtattggggcggcactgcttgcagcctcctattcatcctga

DBGET integrated database retrieval system