KEGG   Lotus japonicus: Lj3g3v0428380.1Help
Entry
Lj3g3v0428380.1   CDS       T04348                                 

Gene name
Lj3g3v0428380.1
Definition
(Kazusa) -
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
lja  Lotus japonicus
Pathway
lja00620  Pyruvate metabolism
lja00710  Carbon fixation in photosynthetic organisms
lja01100  Metabolic pathways
lja01200  Carbon metabolism
Module
lja_M00168  CAM (Crassulacean acid metabolism), dark
lja_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
lja_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
lja_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:lja00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Lj3g3v0428380.1 (Lj3g3v0428380.1)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Lj3g3v0428380.1 (Lj3g3v0428380.1)
Enzymes [BR:lja01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Lj3g3v0428380.1 (Lj3g3v0428380.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2 E2R135
Motif
LinkDB All DBs
AA seq 967 aa AA seqDB search
MANRNLEKMASIDAQLRQLVPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDLKETVQEV
YELSAEYERKHEPQRLEVLGNLITSLDAGDSIVVAKSFAHMLNLANLAEEVQIAHRRRIK
LKKGDFADEGNATTESDIEETFKKLVGEMKKSPQEVFDELKNQTVDLVLTAHPTQSVRRS
LLQKHGRIRNCLTQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTAPTPQDEMRAGM
SYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
DVCLLARMMAANLYYSQIEDLMFELSMWRCNDELRVRAEELTSSSNKDAVAKHYIEFWKN
IPPSEPYRVVLGEVRNRLYQTRERSRHLLANEYSDILEEHTFTNVEEFLEPLELCYRSLC
ACGDRAIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVLDAITKHLGIGSYLEWSEE
KRQQWLLSELSGKRPLFGPDLPQTEEIKDVLDTFHVIAELPSDNFGAYIISMATAPSDVL
AVELLQRECHVKNPLRVVPLFEKLADLETAPAALARLFSVEWYRNRINGKQEVMIGYSDS
GKDAGRFSAAWQLYKAQEELIKVAKEYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTI
HGSLRVTVQGEVIEQSFGEEHLCFRTLQRYTAATLEHGMHPPISPKPEWRALMDEMAVIA
TEEYRSIVFKEPRFVEYFRLATPELEYGRMNIGSRPAKRKPSGGIETLRAIPWIFAWTQT
RFHLPVWLGFGAAFKHVIAKDIRNLNMLQEMYNQWPFFRVTIDLVEMVFAKGDPGIAALY
DRLLVSEDLWSFGEQLRTMFEETKQLLLQVAAHKDLLEGDPYLKQRLRLRDSYITTLNVC
QAYTLKRIRDPNYNVKLRPHISKEAIDVSKPADELVTLNPTSEYAPGLEDTLILTMKGIA
AGMQNTG
NT seq 2907 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacaggaacttggagaagatggcatccattgatgctcagcttcggcaattggtt
cctgctaaagtcagcgaggatgataagctggttgagtatgatgctctgctactggatcgg
ttccttgatattctccaggatttacatggggaggatctgaaagaaactgttcaagaagta
tatgagctttctgctgagtatgaaagaaagcatgaacctcagagactggaagtacttgga
aatctgataactagtttggacgctggagattccattgttgttgccaagtcctttgcccac
atgcttaatttggcaaacttagctgaagaggtccagattgctcaccgccgtaggatcaag
ttgaaaaagggggatttcgctgatgagggcaatgcaaccactgaatcagatattgaagaa
actttcaagaaacttgtaggtgaaatgaagaagtctcctcaggaagtttttgatgaactg
aaaaatcagactgttgatctggttcttactgctcatcctactcaatcagttcgtagatct
ttgctgcagaagcatggaaggatacgaaattgcttaactcaattgtatgccaaagacatc
actcctgatgataagcaggagcttgatgaggctctacagagagagatccaagctgctttc
cgtactgatgaaatcaggagaaccgctccaacaccacaagatgaaatgagagcagggatg
agctactttcatgaaacaatttggaagggtgtgcccaaatttctgcgtcgtgttgataca
gctttgaagaatatagggattaatgagcgtgtcccgtataatgctccacttattcaattt
tcttcttggatgggtggtgatcgtgatggcaatccaagagtaactcctgaagtgacaagg
gatgtttgcttattggctagaatgatggctgctaatttgtattattcacagattgaggat
cttatgtttgaactgtccatgtggcgctgcaatgatgagctgcgtgtccgggctgaggaa
cttaccagttcttccaataaagatgcagttgcaaaacactacatagagttttggaaaaac
attcctccaagtgaaccgtatcgtgtggtactgggtgaagtaaggaacagactctaccag
actcgtgagcgttctcgccatttgcttgctaatgagtactctgacattctagaggaacac
actttcactaatgtggaggagttcctggaacccctcgagctctgttatagatcactttgt
gcctgtggtgatcgggcaattgctgatggaagccttctagattttttgaggcaagtctct
acttttggactgtccctagttaggcttgatattaggcaagagtccgaccgtcatactgat
gtgctggatgccatcaccaaacatttgggaatcggctcctacctggaatggtctgaagaa
aagcggcagcaatggcttttgtccgagttgagtggcaaacgccctctctttggacctgat
cttccccaaactgaagagatcaaagatgttctcgacacatttcatgtcatagcagaactt
ccatctgataactttggagcatatatcatatcaatggcaactgcaccatctgatgtgctt
gcagttgaactcctgcaacgtgaatgccatgtcaagaatccgttaagagtcgtcccattg
tttgagaagcttgctgatctggaaacagctcccgctgctttggctcggttgttctccgtt
gagtggtaccgaaaccggatcaacgggaaacaagaagtcatgattggctattctgattca
ggtaaagatgctggaaggttctctgcagcgtggcagctatataaggctcaagaagagctt
attaaggtagctaaggaatatggtgttaagctaacaatgttccatggtcgtggagggact
gtcggcagaggaggcggtcctactcaccttgctatcctgtctcagcctccagacacaatc
catggatcactccgtgttactgtccaaggagaagttatcgagcagtcatttggagaggag
cacttgtgtttcagaacccttcaacgttacactgcagctactctagaacatggaatgcat
cccccaatttcccccaaaccagaatggcgtgctttgatggacgagatggctgttattgcc
actgaggaataccgttctattgtattcaaagaaccccgttttgttgagtatttccgcctg
gctacaccggagttggagtatggccgaatgaatattggaagtcggccggcaaagagaaag
cctagtggaggcattgagacgctccgcgctataccttggatctttgcctggacacagaca
aggtttcaccttccagtgtggctagggtttggggctgcattcaaacatgtgattgcaaag
gatatcagaaatcttaacatgctgcaagagatgtacaatcaatggcctttctttagggtc
actattgatttagtggaaatggtgttcgccaagggagaccccggtatagctgctttgtat
gacaggctccttgtttcagaagatttgtggtcatttggggaacagttgaggaccatgttt
gaagaaactaagcaactgctacttcaggtggctgcacacaaggatcttcttgaaggtgat
ccttacttgaaacaaagactccggttgcgtgattcttacatcactaccctcaatgtgtgc
caagcttacacattgaagcgaatccgcgatccgaactataatgtgaagctacgcccccac
atctctaaagaggctatagacgtgagtaaacctgcggatgaacttgttactctgaaccca
acaagtgaatatgcacctggtttggaagacaccctcattctcaccatgaagggtattgct
gccggcatgcaaaacactggttaaatc

DBGET integrated database retrieval system