KEGG   Lotus japonicus: Lj3g3v2575550.1Help
Entry
Lj3g3v2575550.1   CDS       T04348                                 

Gene name
Lj3g3v2575550.1
Definition
(Kazusa) -
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
lja  Lotus japonicus
Pathway
lja00220  Arginine biosynthesis
lja00250  Alanine, aspartate and glutamate metabolism
lja00710  Carbon fixation in photosynthetic organisms
lja01100  Metabolic pathways
lja01200  Carbon metabolism
lja01210  2-Oxocarboxylic acid metabolism
lja01230  Biosynthesis of amino acids
Module
lja_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
Brite
KEGG Orthology (KO) [BR:lja00001]
 Metabolism
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Lj3g3v2575550.1 (Lj3g3v2575550.1)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Lj3g3v2575550.1 (Lj3g3v2575550.1)
   00220 Arginine biosynthesis
    Lj3g3v2575550.1 (Lj3g3v2575550.1)
Enzymes [BR:lja01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     Lj3g3v2575550.1 (Lj3g3v2575550.1)
Amino acid related enzymes [BR:lja01007]
 Aminotransferase (transaminase)
  Class I
   Lj3g3v2575550.1 (Lj3g3v2575550.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_MocR Beta_elim_lyase
Motif
LinkDB All DBs
AA seq 526 aa AA seqDB search
MRKSAADRFRLLFNNALVRYRHQHHPPSSSSFSRFLSSTSMASDSVFPVTAGNINPKIVE
CEYAVRGEVVTLAQNLQKELQTNPGSHPFDEILYCNIGNPQSLGQQPITFFREVLALSDY
PALLDKSETQGLFSSDSIERAWQILDQIPGRATGAYSHSQGITGLRETIAAGIQERDGFP
CDPSDIFLTDGASPAVHLMMQLLIRSEQDGILCPIPQYPLYSASITLHGGSLVPYYLDEA
TGWGLEISELKKQLEDAKSKGISVRALVVINPGNPTGQVLSEENQRAIVEFCKKEGLVLL
ADEVYQQNIYVPDKQFHSFKKVSRSMGYGDKDITLVSFQSISKGYHGECGKRGGYMEVTG
FSADVREQIYKVASVNLCSNISGQILASLIMSPPKVGDESYESFMAEKENILSSLARRAK
ILEDGFNKLEGVTCNKAEGAMYLFPQIRLPQKAIKAAEAANTAPDAFYCKRLLNATGVVV
VPGSGFGQVPGTWHFRCTILPQEEKIPAIVSRFTEFHEKFMNEFRD
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgcggaaatccgctgcagacagatttaggctacttttcaacaacgctcttgttcgctat
cgccatcaacatcaccctccttcatcttcttccttctctcgtttcttatcctctacttca
atggcttctgattccgttttccctgttaccgccggtaacatcaaccctaagattgtggaa
tgcgagtatgctgttcgaggagaggttgtcactcttgcccagaatttgcaaaaggagcta
cagaccaatccaggttctcatccatttgatgagatactttactgcaacattggaaatcct
cagtctcttggacagcagccaataacctttttccgagaggttcttgcattatctgactat
ccagctcttttggacaaaagtgaaacacagggtttgttcagttctgactcaattgagcga
gcttggcaaatcttggatcagattcctgggagagcaactggtgcttatagtcatagtcag
ggtattacagggttgcgcgaaacaatagctgctggaattcaagagcgtgatggttttcct
tgcgatcccagtgacattttcttgacagatggtgcaagtccagcagtccatctgatgatg
caattactcataagatcagaacaggacggtattctctgtcccatccctcagtatcctctg
tactcagcctcaatcacactccatggtggcagtctggtaccttactatctagatgaagct
actggttgggggttggaaatatctgaacttaagaagcaattggaagatgccaagtccaaa
ggcatcagtgttagggctttagttgttataaaccctggcaatccaacagggcaggtcctt
tctgaggaaaatcaacgcgctatagtagaattttgcaagaaagaaggtttggttcttttg
gctgacgaggtatatcaacaaaatatttatgttcctgacaagcaatttcactctttcaag
aaagtatctcgatccatgggatatggtgacaaagatatcaccttagtatcttttcagtca
atctccaaaggctatcatggggagtgtgggaaacgtggaggttatatggaggtgactgga
ttttctgcagatgtgagggagcagatatataaagtggcatctgtgaatctctgctctaat
atctctggtcaaattcttgcaagtttgatcatgagtccgcctaaggttggagatgagtcc
tatgagtcattcatggctgagaaggaaaatatcttatcctcccttgctaggcgtgcaaag
attctggaagatggttttaacaaattagagggtgtaacatgcaacaaagcagaaggggca
atgtatctgtttccccaaattcgtctgcctcaaaaggctatcaaagctgcagaggctgca
aatacagcacctgatgccttctactgtaaacgcttgcttaatgccaccggagtggttgtt
gttcctggttctggttttggacaggttcctggaacttggcattttaggtgcaccatattg
cctcaagaagaaaagattccggcaattgtctcccgcttcaccgagttccatgaaaagttc
atgaacgagtttcgtgactgagtc

DBGET integrated database retrieval system