KEGG   Lotus japonicus: Lj3g3v3511350.2Help
Entry
Lj3g3v3511350.2   CDS       T04348                                 

Gene name
Lj3g3v3511350.2
Definition
(Kazusa) -
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
lja  Lotus japonicus
Pathway
lja03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:lja00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    Lj3g3v3511350.2 (Lj3g3v3511350.2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lja03400]
    Lj3g3v3511350.2 (Lj3g3v3511350.2)
Enzymes [BR:lja01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     Lj3g3v3511350.2 (Lj3g3v3511350.2)
DNA repair and recombination proteins [BR:lja03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     Lj3g3v3511350.2 (Lj3g3v3511350.2)
 Prokaryotic type
     Lj3g3v3511350.2 (Lj3g3v3511350.2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDG AAA_29
Motif
LinkDB All DBs
AA seq 299 aa AA seqDB search
MFQPASKRMKPTLTTATTTTTTACKSDNAANGSSLSIDQKSRIEHNKLLAKSKRNLKICL
ERVSKFKASGGSGFVKLEELLVEESWLEALPGELQKPYAVNLSKFVETEICGGDVYPPPH
LIFNALNSTPFHHVKAVILGQDPYHGPGQAMGLSFSVPEGVKVPSSLVNIFKELHKDVGC
SVPSHGNLEKWAVQGVLLLNAVLTVKKHQANSHAKKGWEHFTDAVIKTISQKNEGVVFLL
WGNSARAKSRLIDATKHHILEAAHPSGLSANRGFFGCRHFSRTNQLLEKMGTGPIDWQL
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgttccaacccgcttccaagcgcatgaaacccaccctcaccaccgccaccaccaccacc
accaccgcatgcaaatccgacaacgccgctaatggctcctcactttccattgaccaaaaa
tcgcgcatcgaacacaacaaactcctcgccaaatccaagcggaacctcaaaatctgcctc
gaaagagtctccaaattcaaagcctcaggtggtagcggttttgtgaaattggaggagttg
ctggtggaggaatcgtggttggaagctcttcccggcgaactccagaaaccctacgctgtc
aatctttccaaattcgttgaaacggagatttgcggtggcgatgtgtaccctccgccgcac
ttgatcttcaacgcccttaactccaccccttttcatcatgtcaaggctgtgattctcggc
caggacccttatcatggacctggtcaagcaatgggtctttcattctcagtccctgaggga
gtcaaagttccttccagtttggtgaatatattcaaggagcttcacaaagacgttggctgc
tccgttccgtctcatggtaatctggaaaaatgggctgtgcagggtgttctcttactcaat
gctgttctcacagtcaagaagcatcaagcaaattctcatgcgaaaaaaggctgggaacat
tttacggatgctgttatcaagacaatctcacagaagaatgaaggggttgtgtttctgttg
tggggaaactctgctcgcgcgaaatctaggttaatcgatgcaacaaagcatcacattcta
gaagctgcacatccttctggtttgtctgcaaataggggcttctttggctgcaggcacttc
tcccgcactaaccaacttctggagaaaatggggactggtcctatagattggcaactataa
ctt

DBGET integrated database retrieval system