KEGG   Lotus japonicus: Lj4g3v0166240.1Help
Entry
Lj4g3v0166240.1   CDS       T04348                                 

Gene name
Lj4g3v0166240.1
Definition
(Kazusa) -
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
lja  Lotus japonicus
Pathway
lja00250  Alanine, aspartate and glutamate metabolism
lja00410  beta-Alanine metabolism
lja00430  Taurine and hypotaurine metabolism
lja00650  Butanoate metabolism
lja01100  Metabolic pathways
lja01110  Biosynthesis of secondary metabolites
Module
lja_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:lja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Lj4g3v0166240.1 (Lj4g3v0166240.1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Lj4g3v0166240.1 (Lj4g3v0166240.1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Lj4g3v0166240.1 (Lj4g3v0166240.1)
   00430 Taurine and hypotaurine metabolism
    Lj4g3v0166240.1 (Lj4g3v0166240.1)
Enzymes [BR:lja01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     Lj4g3v0166240.1 (Lj4g3v0166240.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
LinkDB All DBs
AA seq 487 aa AA seqDB search
MHFTLAFPKPGSDLCLRSNFASRYVRASLPRFSMPENSMPKKAAYQNIHDELKLDANPKM
NLASFVTTSMEEECNKLMMESINKNYVDMDEYPATTDLHNRCVNMIARLFHAEIGENESA
IGAGTVGSSEAIMLAGLAFKKRWQNKRKAEGKPYDKPNIVTGANVQVCWKKFASYFDVEL
REVKLSEGNYVMDPAKAVEMVDENTICVAAILGSTYNGEFEDVKLLNDLLLEKNKQTGWG
TPIHVDAASGGFIAPFIYPELEWDFRLPLVKSINVSGHKYGLVYAGIGWVIWRSKEDLPE
ELVFHINYLGADQPTFTLNFSKGSSQIIAQYYQLIRLGKEGYKSIMENCRENAMVVKERL
EKIGCFNILSKDDGVPVVAFSLKDRSRYDEFKISKMLRRLGWVVPAYPMPPGAQHINALR
VVVRADLSRTLAECLVLDIENVVHELEKLHPKYPAKTINIKEKKSAFDARRKIIAPESNK
LQKIMAA
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgcacttcaccttggcttttccaaaaccagggtctgatctctgtcttcgctctaacttt
gcttctcgttatgtcagggcttctcttcctaggttcagcatgccagagaactctatgcca
aagaaggctgcataccagaacatacacgatgagctgaagcttgatgcgaatccaaagatg
aacttggcttcctttgtaaccacatccatggaggaagaatgtaacaagctcatgatggaa
tccatcaacaagaactatgtagacatggatgagtaccctgctaccactgatcttcataat
cgatgtgtaaacatgatagcacgtttgttccatgctgaaattggagaaaatgagagtgca
attggagcaggaactgttggatcatctgaggccataatgctggcaggccttgccttcaag
aagaggtggcagaacaagcgcaaggctgagggcaagccctatgataagcccaacattgtc
acaggtgccaatgtgcaggtatgttggaagaaatttgctagttattttgatgtggagttg
agagaagtgaagctgagtgaaggcaactacgtgatggaccctgccaaggccgttgagatg
gtggatgaaaacacaatttgtgtggctgcaatcttgggttcaacttacaatggagaattt
gaagatgtcaagctcttgaatgacctgttgctagaaaaaaacaagcaaactggatggggt
acacctattcatgttgatgctgctagtggtggctttattgctcctttcatttatccagag
ctggaatgggatttcagactcccattggtgaagagcatcaatgtcagtggccacaagtat
ggacttgtttatgccggaattggttgggttatatggagaagcaaggaagacttgccagaa
gaacttgtcttccacattaattaccttggagctgaccaacctacattcaccttgaatttt
tctaaaggttctagtcagatcattgctcaatattatcagctaattcgcctaggcaaagag
gggtataagagcataatggagaactgcagagaaaatgctatggtggtgaaggaacgcttg
gaaaagattggatgctttaacatactctcaaaagacgatggtgttcctgtggtggcattt
tctttgaaggacagaagccgctatgatgagttcaagatatcaaagatgttgcgccgtctc
ggttgggtagtgccagcttatccaatgccaccgggtgctcagcacatcaatgcactccgt
gtggtggtcagggctgatctttcacgcacacttgctgaatgccttgtgcttgatattgaa
aatgtggtgcatgagcttgagaaacttcaccccaagtaccctgccaaaacgatcaacatt
aaggaaaagaagagtgcatttgatgcacgcaggaaaatcattgctccagaatcaaataaa
cttcagaaaatcatggctgcctagagt

DBGET integrated database retrieval system