KEGG   Lotus japonicus: Lj4g3v0948900.1Help
Entry
Lj4g3v0948900.1   CDS       T04348                                 

Gene name
Lj4g3v0948900.1
Definition
(Kazusa) -
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
lja  Lotus japonicus
Pathway
lja00020  Citrate cycle (TCA cycle)
lja00190  Oxidative phosphorylation
lja01100  Metabolic pathways
lja01110  Biosynthesis of secondary metabolites
lja01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Lj4g3v0948900.1 (Lj4g3v0948900.1)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Lj4g3v0948900.1 (Lj4g3v0948900.1)
Enzymes [BR:lja01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Lj4g3v0948900.1 (Lj4g3v0948900.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA FAD_binding_3 Thi4 DAO HI0933_like Lycopene_cycl Pyr_redox_3
Motif
LinkDB All DBs
AA seq 561 aa AA seqDB search
MWRCVARAVRGSSSSERSNLSHQPLRSHFSRFFTSGSYNVVDHKYDAIVVGAGGAGLRAA
IGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTIKGSDWLGDQD
AIQYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLNFGKGGQAYRCACAADRTG
HALLHTLYGQAMKHNTQFFVEYFALDLLMNSEGSCQGVIALNMEDGTLHRFQASSTILAT
GGYGRAYFSATSAHTCTGDGNAMVARAGIPLEDQEFVQFHPTGIYGAGCLVSEGCRGEGG
ILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGKHKDHIYLHLNHLPPDVL
KERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTIKGDDPDAVVPGL
MAAGEAACASVHGSNRLGANSLLDIVVFGRACANRVAEVHKPGEKQQPLEKDAGMKTIAW
LDKFRNSNGSLLPSEVRLNMQRVMQNNASVFRTEETLKEGCKLIDKTWESFHDIKLKDRG
LIWNTDLIETIELENLLINAC
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgtggcggtgcgtggctcgtgctgttcgcggatcatcttcctcagagagatccaatctt
tctcatcaaccacttcgatctcatttttcaagattcttcaccagtggttcttacaatgtg
gtggatcataaatacgacgcgattgttgttggtgctggtggcgcagggttgagagccgct
attggactctctgaacatggcttcaacactgcgtgcatcaccaagctcttcccgactcgt
tcacacactgttgcagctcagggtggtataaatgctgcattgggaaatatgactgaagat
gactggaggtggcacatgtatgacactatcaagggaagtgattggctaggagaccaagat
gccatccaatatatgtgtagggaggcaccaaaagcagtgattgagcttgaaaattatgga
ctgccattttcacgaaccgaggatggaaagatataccagcgtgcatttggtggtcagagc
ttgaactttggaaaaggtggtcaagcatatcgttgcgcatgtgctgctgatcgtactggg
catgctttattgcacactctctatggccaggctatgaagcataatacccagttttttgta
gaatattttgcattagatcttttgatgaacagtgaaggtagttgccaaggagtaattgcc
ttgaatatggaagatggaacattacatcgattccaagcatcttcaaccattttggccact
gggggttatggtagagcatacttttctgcaacctcagcacatacatgcactggtgatggc
aatgccatggttgctcgtgctgggatcccacttgaggatcaagagtttgtgcaatttcac
ccaacaggcatatatggagctggttgccttgtctcagaagggtgtcgcggtgaaggtgga
attcttaggaatagtgagggtgagaggtttatggaaagatatgctcctactgcgaaggat
cttgcatcacgagatgtagtttctagatcaatgactatggagattcgggaaggtcgtggt
gtaggaaaacataaagatcacatctatcttcacttgaatcacttacctccagatgttctg
aaggagagactacctggtatatccgaaactgcagctatttttgctggtgtggatgttaca
aaggaacccattcctgtcttgccaacagtgcattataacatgggtggtattcccacaaac
tatcatggagaggtggttaccattaaaggtgatgatccagatgcagtagttcctggatta
atggctgctggggaagcagcctgtgcgtcagtgcatggttccaataggcttggtgcaaat
tcacttctggacattgtagtttttggtagagcttgtgcaaatagagttgcagaagttcat
aagccaggggagaaacaacagcctttggagaaagatgctggtatgaaaacgattgcttgg
cttgacaaatttagaaattcgaatgggtctttgctaccttcagaagttcggttgaatatg
caacgtgtaatgcaaaacaatgcttctgttttccgcacagaagaaacattaaaagaaggt
tgcaaattaattgataaaacatgggagagctttcatgatatcaaattgaaggatcggggt
ttgatatggaacactgacttgattgagactattgagttggaaaatcttttgataaatgcc
tgc

DBGET integrated database retrieval system