KEGG   Lotus japonicus: Lj4g3v1440870.1Help
Entry
Lj4g3v1440870.1   CDS       T04348                                 

Gene name
Lj4g3v1440870.1
Definition
(Kazusa) -
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
lja  Lotus japonicus
Brite
KEGG Orthology (KO) [BR:lja00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lja03036]
    Lj4g3v1440870.1 (Lj4g3v1440870.1)
Enzymes [BR:lja01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Lj4g3v1440870.1 (Lj4g3v1440870.1)
Chromosome and associated proteins [BR:lja03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     Lj4g3v1440870.1 (Lj4g3v1440870.1)
   HDAC complexes
    Sin3A-HDAC complex
     Lj4g3v1440870.1 (Lj4g3v1440870.1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    Lj4g3v1440870.1 (Lj4g3v1440870.1)
  Chromatin remodeling factors
   NuRD complex
    Lj4g3v1440870.1 (Lj4g3v1440870.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
LinkDB All DBs
AA seq 468 aa AA seqDB search
MVMEEERKIEEGASLPSGPDAKKKRVTYFYEPSIGDYYYGQGHPMKPHRMRMAHNLIVHY
SLHRRMEINRPFPAGPDDIRRFHSDDYVEFLASVTPETLSEPIFARQLKRFNVGEDCPIF
DGLFNYCQASAGGSLGAAVKLNRGEADIAINWAGGMHHAKKCEASGFCYVNDIVLGILEL
LKVHRRVLYIDIDVHHGDGVEEAFYTTDRVMTVSFHKFGDFFPGTGHIKDIGVGSGKHYA
LNVPLNDGMDDENFRVLFQAVIQKVMEVYQPEAVVLQCGADSLSGDRLGCFNLSVKGHAD
CLRFVKSFNVPLMIVGGGGYTIRNVARCWCYETAVAVGVEPDNKLPYNEYYEYFGPDYTL
HVDPSNMENLNTPKDLERIRNTLLEQISRLPHAPSAPFQTTPSTTEVPEEEEEGMDRRPQ
CRKWNGEEYDSDFDEDEKDDLKHSKLTDHMRDVSNDMEEEKPVVHPPS
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggttatggaggaggagagaaagatagaggaaggtgcttcccttccatcgggaccagac
gcgaagaagaagagagtcacctacttctacgaaccatcgatcggcgattactactacggc
caaggccacccgatgaaaccccaccggatgcgtatggcccacaatctcatcgtccattac
tccctccaccgccgcatggagatcaatcgccccttccccgccggccctgacgacatccgc
cgcttccactccgacgactacgtcgagtttcttgcctctgtcacccctgagactctctcg
gagccaatcttcgcccgccagcttaagcgcttcaacgttggtgaggattgtcctattttt
gatggtcttttcaattactgccaggcctccgccggtggctccctcggcgccgccgtcaag
ctcaaccgcggtgaggctgacattgctatcaattgggctgggggcatgcatcatgctaag
aagtgtgaagcttctggcttctgttatgtcaatgacattgtgcttggtatcctcgagctt
ctcaaagttcataggcgtgtgctgtacattgacatagatgttcaccatggtgatggtgtg
gaagaggccttctacacaactgatagagtgatgacagtatctttccataagtttggggac
tttttccccggcactggacacatcaaggacattggagtgggctcaggaaagcattatgct
ctcaatgtcccattaaatgatggaatggatgatgaaaatttccgtgttctgtttcaagct
gtcattcaaaaagtcatggaggtttatcagcccgaagcggttgttcttcaatgtggagct
gattccttgtctggtgataggttgggttgcttcaacttgtctgtgaaaggtcatgcagat
tgccttcgtttcgttaaatctttcaatgttcctctaatgattgttggtggcggaggatat
acgattcggaatgtggctcgttgttggtgttatgagactgcagtagcagtaggagtggag
cctgataacaagctgccttacaatgaatactatgagtattttggcccagattatactctc
catgttgatccaagcaacatggagaacctaaacacacccaaggatttggaaagaataagg
aacactttactagaacagatttcccgacttccccatgctcccagtgcaccttttcagaca
acaccatcaaccacagaagtgccagaagaggaggaagagggcatggatagaagaccacag
tgtcgcaagtggaatggtgaagagtatgattctgattttgatgaagatgaaaaggatgac
ctcaagcactcaaaattaactgaccatatgagggatgtttcaaatgacatggaagaagag
aagccagtagtgcatccaccatcttgatgt

DBGET integrated database retrieval system