KEGG   Lotus japonicus: Lj4g3v1534920.2Help
Entry
Lj4g3v1534920.2   CDS       T04348                                 

Gene name
Lj4g3v1534920.2
Definition
(Kazusa) -
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
lja  Lotus japonicus
Pathway
lja00010  Glycolysis / Gluconeogenesis
lja00053  Ascorbate and aldarate metabolism
lja00071  Fatty acid degradation
lja00280  Valine, leucine and isoleucine degradation
lja00310  Lysine degradation
lja00330  Arginine and proline metabolism
lja00340  Histidine metabolism
lja00380  Tryptophan metabolism
lja00410  beta-Alanine metabolism
lja00561  Glycerolipid metabolism
lja00620  Pyruvate metabolism
lja01100  Metabolic pathways
lja01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lja00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lj4g3v1534920.2 (Lj4g3v1534920.2)
   00053 Ascorbate and aldarate metabolism
    Lj4g3v1534920.2 (Lj4g3v1534920.2)
   00620 Pyruvate metabolism
    Lj4g3v1534920.2 (Lj4g3v1534920.2)
  Lipid metabolism
   00071 Fatty acid degradation
    Lj4g3v1534920.2 (Lj4g3v1534920.2)
   00561 Glycerolipid metabolism
    Lj4g3v1534920.2 (Lj4g3v1534920.2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Lj4g3v1534920.2 (Lj4g3v1534920.2)
   00310 Lysine degradation
    Lj4g3v1534920.2 (Lj4g3v1534920.2)
   00330 Arginine and proline metabolism
    Lj4g3v1534920.2 (Lj4g3v1534920.2)
   00340 Histidine metabolism
    Lj4g3v1534920.2 (Lj4g3v1534920.2)
   00380 Tryptophan metabolism
    Lj4g3v1534920.2 (Lj4g3v1534920.2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Lj4g3v1534920.2 (Lj4g3v1534920.2)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Lj4g3v1534920.2 (Lj4g3v1534920.2)
Enzymes [BR:lja01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Lj4g3v1534920.2 (Lj4g3v1534920.2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
LinkDB All DBs
AA seq 543 aa AA seqDB search
MAARTLSYLLSRSRSLSSSSGAASLLPSLGGKSGGWRNSNSHRYSTAAEVEELITPQVSI
NYTQHLINGKFVDAASGKTFPAYDPRTGDVIAHVAEGDAEDVNRAVAAARKAFDEGPWPR
MTAYERSRILLRFADLVEKHNDEIAALETWNNGKPYEQAAKAEVPMLVRLFRYYAGWADK
IHGLTVPADGNYHVQTLHEPIGVAGQIIPWNFPLIMFAWKVGPALACGNTIVLKTAEQTP
LTALVVAKLLHEAGLPPGVLNIVSGYGPTVGAPLASHMDVDKLAFTGSTDTGKVVLGLAA
KSNLKPVTLELGGKSPFIVCEDADVDKAVELAHFALFFNQGQCCCAGSRTFVHERVYDEF
LEKSKKRALRRVVGDPFKKGVEQGPQIDTEQFEKILRYIKSGIESNATLECGGDRLGSKG
FYVQPTVFSNVQDDMLIAQDEIFGPVQTIFKFKEIDEVIRRANSTRYGLAAGVFTQNLAT
ANTLMRALRAGTVWINCFDVFDAAIPFGGYKMSGIGREKGIYSLLNYLQVKAVVTPLKNP
AWL
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggctgctcgcactctttcttatctgctttctcgctctcgctctctttcttcttcttct
ggagctgcttctctgcttccctcacttggaggaaaatctggagggtggagaaacagtaac
agtcacagatatagtactgcagcagaagttgaggaattgatcactccacaagtttcaatc
aattacacacagcatctcataaatgggaaatttgtggatgctgcatcagggaaaactttt
ccagcctatgacccgcgcacaggggatgtgattgctcatgttgctgaaggcgatgctgaa
gatgtcaaccgtgcggtggcagcagctcgcaaggcctttgatgaaggcccttggccaaga
atgactgcttatgaaagaagtcggatattgctgcgcttcgctgatttggttgagaagcac
aacgatgagattgcagctctggagacatggaacaatggaaagccttatgaacaggcagcc
aaggctgaagtgccaatgttggtgcgtttatttcgctattatgctggctgggcagataaa
attcatgggttgactgtccctgctgatggaaattatcatgtccagacattgcatgaacca
attggtgtagcaggacaaattataccttggaactttcctctaattatgtttgcttggaaa
gttggaccagctctagcatgtggtaacaccattgtccttaagactgctgagcaaacaccg
ctaacggctcttgttgtggcaaaattacttcatgaggctggtcttcccccaggtgtgctg
aacatagtttccgggtatggtccgactgttggtgcacctcttgcaagtcacatggatgtg
gacaagctagcattcactggatcaactgatactggaaaagttgtacttggattggctgca
aaaagtaatcttaagccagtgacattggagcttggagggaaatcacctttcatagtatgt
gaggatgctgatgttgacaaggctgttgagcttgcacacttcgctctgttctttaatcag
gggcaatgttgctgtgctgggtctcgaacctttgtacatgagcgtgtctatgatgagttc
ttggagaaatcaaagaaacgggctttgaggcgtgttgttggtgatccgttcaaaaagggt
gttgaacaaggtcctcagattgatacagaacaattcgagaaaattcttaggtacatcaaa
tctggaattgaaagcaatgccacccttgagtgtggcggtgatcgattggggtcaaaaggc
ttctatgtccagccaaccgtcttctcaaatgttcaggatgatatgctgatagcacaagat
gaaatctttggccctgttcagaccattttcaaattcaaggaaattgatgaagtaattcga
cgggcaaattcaacgcggtatggtctagcggctggtgtgttcacccagaacttggccact
gccaacactttgatgagggcactgagagctggaactgtgtggatcaattgctttgatgtg
tttgatgctgcaattccttttggtggttacaagatgagtgggattggaagggagaaaggg
atctacagtcttctcaactaccttcaggtgaaagctgttgtcacaccattgaagaatcct
gcgtggctgtaa

DBGET integrated database retrieval system