KEGG   Lotus japonicus: Lj5g3v1303350.2Help
Entry
Lj5g3v1303350.2   CDS       T04348                                 

Gene name
Lj5g3v1303350.2
Definition
(Kazusa) -
  KO
K09667  protein O-GlcNAc transferase [EC:2.4.1.255]
Organism
lja  Lotus japonicus
Pathway
lja00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:lja00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    Lj5g3v1303350.2 (Lj5g3v1303350.2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:lja01003]
    Lj5g3v1303350.2 (Lj5g3v1303350.2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lja03036]
    Lj5g3v1303350.2 (Lj5g3v1303350.2)
Enzymes [BR:lja01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.255  protein O-GlcNAc transferase
     Lj5g3v1303350.2 (Lj5g3v1303350.2)
Glycosyltransferases [BR:lja01003]
 O-Glycan biosynthesis
  O-linked GlcNAc type
   Lj5g3v1303350.2 (Lj5g3v1303350.2)
Chromosome and associated proteins [BR:lja03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    NSL complex
     Lj5g3v1303350.2 (Lj5g3v1303350.2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_41 TPR_1 TPR_11 TPR_2 TPR_8 TPR_7 TPR_17 TPR_12 TPR_16 TPR_14 TPR_19 TPR_10 TPR_9 NARP1 TPR_6 BTAD TPR_MalT ANAPC3 TPR_15 EST1_DNA_bind TPR_21 Coatomer_E COMM_domain
Motif
LinkDB All DBs
AA seq 949 aa AA seqDB search
MISVQGDHHRHQYHHHLQIPGSSDTSRLQFTADRVEPFSVKQEPSLTLLPLRSHDSSEVD
EDLHLSLAHQMYKSGSYKKALEHSNIVYDRNPLRTDNLLLLGAIYYQLHDFDMCVAKNEE
ALRVEPHFAECYGNMANALKEKGNIDLAIRYYLIAIEFRPNFADAWSNLASAYMRKGRLT
EAAQCCRQALAINPLMVDAHSNLGNLMKAQGLVQEAYSCYLEALRIQPTFAIAWSNLAGL
FMESGDFNRALQYYKEAVKLKPSFPDAYLNLGNVYKALGMPQEAIACYQHSLQTRPNYAM
AYGNLASIYYEQGQLDMAILHYKQAIGCDPRFLEAYNNLGNALKDVGRVEEAIQCYNQCL
SLQANHPQALTNLGNIYMEWNMVAAAASYYKATLSVTTGLSAPYNNLAIIYKQQGNYADA
ISCYNEVLRIDPLAADGLVNRGNTFKEIGRVSDAIQDYIRAITVRPTMAEAHANLASAYK
DSGHVEAAVKSYKQALILRADFPEATCNLLHTLQCVCSWEDRDKMFKEVEGIIRRQINMS
VLPSVQPFHAIAYPLDPMLALDISRKYAAHCSVIASRFALPPFSHPASIPIKREGGYERL
RVGYVSSDFGNHPLSHLMGSVFGMHNRKNVEVFCYALSPNDGTEWRQRIQSETEHFVDVS
AMSSDMIAKMINEDKIQVLVNLNGYTKGARNEIFAMKPAPIQVSYMGFPGTTGASYIDYL
VTDEFVSPLQYAHIYSEKIVHLPHCYFVNDYKQKNLDVLDPNCQHKRSDYGLPEDKFLFA
CFNQLYKMDPDIFNTWCNILKRVPNSALWLLRFPAAGEMRLRAYAVAQGVQPDQIIFTDV
AMKQEHIRRSSLADLFLDTPLCNAHTTGTDILWAGLPMVTLPLEKMATRVAGSLCLSTGL
GEEMIVSSMKEYEERAVSLALNRPKLQALTNKLKAIRTTCPLFDTARWV
NT seq 2847 nt NT seq  +upstreamnt  +downstreamnt
atgatctccgtgcagggagaccaccaccgccaccagtaccaccaccacttgcagattcct
ggttcttccgacacttctcggcttcagttcaccgcggatcgcgttgaaccgttctccgtt
aagcaggaaccctcgctcactcttttgcccttgcgcagccatgattccagtgaagttgat
gaagatttgcatctgtcccttgcacatcaaatgtacaaatctggaagttataagaaagcg
ctagaacatagcaacattgtctatgacagaaatccgctccgtactgataacttactgctc
ctcggagcaatttactaccagttgcatgattttgatatgtgtgtggcgaagaatgaagaa
gcacttagggtggagccacacttcgccgagtgttatgggaatatggcaaatgcattgaaa
gaaaaaggcaacattgaccttgcaattcgctactacttgattgccattgagtttcgtccc
aattttgctgacgcatggtcaaacctagctagcgcatacatgcgtaaaggaagactcact
gaagcagctcagtgttgtcgtcaagcacttgctataaaccctctaatggttgatgctcat
agcaacttgggtaatctaatgaaagctcaagggctggtccaagaagcatacagttgttac
cttgaggcattgcgcattcagcctacctttgctattgcatggtcaaatcttgctggtctg
ttcatggaatctggtgatttcaacagagcccttcagtattacaaggaagctgtaaaacta
aaaccttctttccctgatgcttatctgaaccttgggaatgtgtacaaggctctagggatg
cctcaagaagctattgcatgctatcaacattctcttcaaacacgaccaaactatgccatg
gcttatggtaatttggccagtatatactatgagcaaggtcaactggacatggcaattcta
cactataaacaagctattggatgtgaccccagatttttggaagcttacaataatttgggt
aatgctctaaaagatgttggcagagtggaggaagcaatccagtgctataatcaatgcctt
tcattgcaggctaaccatccacaggctttgaccaatcttggaaatatatacatggaatgg
aacatggtagctgctgctgcttcatattataaagctacactgagtgtgaccactggatta
tccgctccttataacaatcttgctataatctataagcagcagggaaattatgcagatgcc
atatcatgctacaatgaggtcctccgcattgatcccttggctgctgatggtctggtaaat
agagggaatacatttaaggagattggtagagttagtgatgctatccaggattacatacgt
gcaattactgtcaggcctactatggctgaagcccacgctaatttggcgtcagcttataaa
gatagtggacatgttgaggctgctgtgaagagctataaacaggcattgattcttcgtgca
gactttcctgaagcaacttgcaatctcctacatacacttcagtgtgtctgttcttgggag
gatcgtgataaaatgttcaaggaggttgaagggataatcaggagacagattaatatgtca
gttcttccaagtgtccagcctttccatgcaatagcatatccactggaccccatgcttgct
ctggacattagtcgaaaatatgctgcacactgctctgtaattgcttcccgttttgctctt
ccaccattcagccatcccgcttctattccaatcaagcgggagggaggttacgaaagacta
agggttgggtatgtgagtagtgactttggtaatcaccccttgtcacatctcatgggatct
gtttttggtatgcataataggaagaatgttgaggtattctgttatgccttgagtccaaat
gatggtactgagtggagacagcgtatacagtctgaaacagagcactttgtggatgtatct
gccatgtcatcggatatgatagcaaaaatgatcaatgaggataaaatacaagtccttgtc
aatcttaatggttatacgaagggtgccagaaatgagatatttgctatgaaacctgcacct
attcaagtttcatatatgggattccctggaacaacaggggcttcttacatagactattta
gtcactgatgagttcgtgtccccgttacagtatgcacacatttattctgaaaagattgtc
cacctgccccattgctactttgttaatgattataaacagaaaaatctggatgtgttggac
ccaaactgccagcacaaacgatcagattatggtctacctgaggataaatttctgttcgca
tgcttcaatcaactttacaagatggatcctgatatatttaacacatggtgcaatattctt
aaacgtgtacccaacagtgcactttggctcctgcgatttcctgcagcaggcgaaatgaga
ctgagggcatatgctgttgcacaaggggtacagcccgatcaaataatttttactgatgtt
gcaatgaagcaggaacacatcagacggagttctttagcagacttattccttgacacgcct
ttatgcaatgcacatacaactggaacagatatattatgggcaggcttgccaatggttact
ctgcctcttgagaaaatggctactagagtcgctgggtcactctgtctctcgactggactc
ggggaggagatgattgttagcagcatgaaagagtatgaagaaagggcagtatcactagct
ctgaatcgcccgaagcttcaagctcttactaacaagctcaaagcaatacgcacaacctgc
cctctattcgacacagctcgctgggtg

DBGET integrated database retrieval system