KEGG   Lotus japonicus: Lj6g3v1330870.1Help
Entry
Lj6g3v1330870.1   CDS       T04348                                 

Gene name
Lj6g3v1330870.1
Definition
(Kazusa) -
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
lja  Lotus japonicus
Pathway
lja03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:lja00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Lj6g3v1330870.1 (Lj6g3v1330870.1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lja03400]
    Lj6g3v1330870.1 (Lj6g3v1330870.1)
Enzymes [BR:lja01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Lj6g3v1330870.1 (Lj6g3v1330870.1)
DNA repair and recombination proteins [BR:lja03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     Lj6g3v1330870.1 (Lj6g3v1330870.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N RNA_ligase
Motif
LinkDB All DBs
AA seq 270 aa AA seqDB search
MARDSQDALRLINWRKGGAKTGASAGNFALVASEVLQLRQGTASGGLTIKELNDLLDQLA
SSENRAEKNLGLSTLIRKTNTQEMKWIIMIILKDLKLGISEKSIFHEFHPDAEDLFNVTC
DLKLVCEKLKDRNQRHKRQDIEVGKAVRPQLAKRVANAAEAWKKLHGKEVVVECKFDGDR
IQIHKNGTEIHFFSRNFLDHSEYAHAMSAIIIQNILVDRCILDGEMLVWDTSLNRFAEFG
SNQEIAKAARDGLDSHRKLCCILLSGQLKY
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggctagggattctcaggatgctctccgcctcatcaattggcgtaaaggcggtgctaaa
actggtgctagtgccggcaatttcgcactcgtcgcctctgaggtgctgcagcttaggcaa
gggactgcttctggtggtttgacgataaaggagttgaatgacttgcttgatcaattggct
tcgagcgaaaacagggctgagaagaatctgggtctttctacccttatcagaaagacaaat
acacaggaaatgaagtggattatcatgataattctcaaagatctaaagctgggaattagt
gaaaaaagcattttccatgaattccatccagatgccgaagacttgtttaatgttacatgt
gacttaaaattagtttgtgaaaagctaaaggatcggaaccagcgccataaacggcaggat
attgaagttggaaaagctgtgcgccctcaattagctaagagagttgctaatgcagctgaa
gcatggaaaaagcttcatgggaaggaagttgttgttgagtgcaaatttgatggtgatcgc
attcaaattcataaaaatggaacagagatacatttcttctcaaggaactttcttgatcat
tctgaatatgcacatgcaatgtcagcaatcataatacaaaacattcttgtagacaggtgt
atccttgatggtgaaatgttggtctgggacacatccttgaatcgttttgctgagtttggc
tcaaatcaggaaatagccaaggcagcaagggatggacttgatagtcatagaaagttatgc
tgtatccttctctctggacaactcaagtattaa

DBGET integrated database retrieval system