KEGG   Lotus japonicus: Lj6g3v1618370.1Help
Entry
Lj6g3v1618370.1   CDS       T04348                                 

Gene name
Lj6g3v1618370.1
Definition
(Kazusa) -
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
lja  Lotus japonicus
Pathway
lja00052  Galactose metabolism
lja00500  Starch and sucrose metabolism
lja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lja00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Lj6g3v1618370.1 (Lj6g3v1618370.1)
   00500 Starch and sucrose metabolism
    Lj6g3v1618370.1 (Lj6g3v1618370.1)
Enzymes [BR:lja01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     Lj6g3v1618370.1 (Lj6g3v1618370.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
LinkDB All DBs
AA seq 903 aa AA seqDB search
MSTSFRTETRTTLITPLPLLLLSFYISICVIFCHADSSSSSQVGYGYTISTVNNDPTENA
LTANLNLIKSSSVFGPDIPHLNIVASFETKDRLRVKITDSIHQRWEVPQQVIPRVSSLTY
PLRSLKQSSGSNHLQDEEAKQSLTLTHPNSDLIFTLHNTTPFGFTVSRKSSNDVLFDAAP
DPSNPATFLIFKEQYLQLSSSLPAPRASLYGLGEHTKSSFKLQHNQTLTLWNADIGSSNL
DLNLYGSHPFYLDVRSPSPDGRVKAGTTHGVLLLNSNGMDIVYGGERVTYKVIGGIFDLY
FFAGSSPELVLEQYTEFIGRPAPMPYWSFGFHQCRYGYKNVFDVKDVVANYAKAGIPLEV
IWTDIDYMDAYKDFTVDPINFPLAEMRGFVNTLHQKGQKYVLILDPGINVNETYATYVRG
LQADVYIKRNGVNYLAEVWPGPVYYPDFLNPRSQVFWGGEIKLFRDLLPFDGLWLDMNEL
SNFNTSPPIPSSSLDNPPYKINNSGVQRPINNKTVPATSLHFGNITEYDAHNLYGLLEAK
VTNKALVDITGIRPFILSRSTFVSSGKYTAHWTGDNAATWNDLAYSIPSILNSGIFGIPM
VGADICGFTGDTTEELCRRWIQLGAFYPFARDHSDKNSIRQELYLWSSVAASARKVLGLR
YRLLPYFYTLMYEANTIGTPIARPLFFSFPEDVKTYDINSQFLVGKGVLVSPVLKPGAVT
VDAYFPAGSWFDLFNFSNSVNVESGKHVTLDSPSDHINVHVGEGNILALQGEAMTTEAAR
KTAFQLVVVVSSSKDSYGQVYLDDGEALDMAGGEGQWTLVRFYSALQNNTVFVSSEVTNG
RFALDQGWIIDKVTFLGIPKNRRFGRMDLAVNGTDSMRKTAVKTQIYTSSEFVIVEASKL
SQL
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccagtttcagaactgaaaccagaaccactctcatcactccactaccactacta
ctactatccttctacatctctatctgtgtcatcttttgccacgcagattcatcatcatca
tcacaagttggttatggctacaccatctcaactgtgaacaatgatcccactgaaaatgct
ttgactgcaaaccttaaccttatcaaatcctcctctgttttcggccctgacattccacac
ctcaacatcgttgccagttttgagaccaaggacaggttaagagtaaaaatcactgattca
attcaccagaggtgggaagttccacaacaagtgattccaagagtctcttctctaacctac
cctcttcgctccctcaagcaaagttcaggttcaaatcatcttcaagatgaagaagcaaaa
caatctctcactctcacacatccaaactcagacctcatcttcaccctccacaacaccacc
ccttttggcttcactgtctcacgcaaatcctccaacgatgtcctcttcgacgccgcgccg
gacccttcaaaccctgcaacgtttctcatcttcaaggagcaatatttgcagctatcatct
tcacttccagctccaagagcctccctttatggccttggagaacacactaagagctccttc
aagttgcagcacaatcaaaccctcacgctgtggaatgctgatattggtagctccaacctt
gacttgaacctatacggttctcacccgttttacttggatgttagatcaccctcccctgat
ggaagagtgaaggctggaaccactcatggggtgttgctgctcaatagcaatggaatggac
attgtgtatggtggtgagcgtgttacttataaagttattggtgggattttcgatctgtat
tttttcgccggatcgtctccggaattggtgttggaacagtacactgaattcattggcagg
cctgctcccatgccttattggtcctttggttttcatcagtgccgatatggctacaagaat
gtatttgatgtcaaggatgtggttgccaactatgcaaaagcaggtataccccttgaagtt
atatggacagatattgattacatggatgcatataaagatttcacagttgaccctatcaac
tttccactggctgagatgagaggatttgttaatactcttcaccaaaagggtcaaaaatat
gtccttatcttggatcctggtatcaatgtgaatgaaacatatgcaacctatgttagaggt
ttgcaggctgatgtctacataaagagaaatggagtcaactatcttgctgaagtttggcct
ggaccagtctactatcctgattttctaaatcctcgcagccaagtgttttggggtggagaa
atcaaactatttcgggaccttctccctttcgacggtctttggcttgacatgaatgagtta
tctaattttaacacttctcctcccattccatcttctagtctcgataaccctccctacaaa
attaacaattctggagttcaacgacccattaataacaaaacagtcccagcaacatcttta
cactttggtaatatcactgagtatgatgcacacaatttgtatggactgctagaagccaaa
gtaactaacaaggctttggtggacataactggtataaggccattcattctaagtagatca
acttttgtaagctccggtaagtacacagcccactggacaggagataatgctgctacatgg
aatgatttagcatactcaatcccatcaatattgaattctggtatctttggaattccaatg
gttggagctgatatatgtggcttcacaggagatacaactgaagaactttgccggcgctgg
atccagctgggggccttttacccctttgcgagagatcattcagacaaaaattccattagg
caagagctttacctttggagttcggttgctgcatcagctaggaaagtgcttggcctccgt
tatcgtcttctcccttatttctacacactaatgtatgaagcaaatacaatagggacacca
attgcacggccccttttcttttctttccctgaggatgtcaaaacatatgacataaactca
cagtttctagtaggtaaaggggttttggtatcccctgtactaaaacctggggcagtcaca
gttgatgcatactttcctgcaggaagctggtttgacctcttcaatttctcaaattcagtg
aatgtagaatcaggcaagcatgtcactcttgattcaccatcagatcatataaatgtgcat
gttggggaaggtaatattttggccttgcaaggagaagcaatgacaactgaagcggcccgg
aagactgcatttcaacttgtggtggttgtcagtagcagcaaagatagttatggacaagtc
tatttggatgatggggaggcacttgacatggcaggaggggaagggcaatggacacttgta
agattttatagcgcattacagaacaataccgtttttgtttcatctgaggttactaatgga
agatttgctttggaccaagggtggatcatagataaggttactttcttagggatacctaag
aataggagatttggtaggatggatttggctgtgaatggaacagattcaatgaggaagaca
gctgtgaagacacagatttatacatcatctgagtttgttattgtagaagcttcaaaattg
tcccagctt

DBGET integrated database retrieval system