KEGG   Lactobacillus johnsonii FI9785: FI9785_1414
Entry
FI9785_1414       CDS       T01120                                 

Gene name
pbp
Definition
(GenBank) Penicillin-binding protein
  KO
K21465  penicillin-binding protein A
Organism
ljf  Lactobacillus johnsonii FI9785
Pathway
ljf00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ljf00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    FI9785_1414 (pbp)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ljf01011]
    FI9785_1414 (pbp)
Peptidoglycan biosynthesis and degradation proteins [BR:ljf01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   FI9785_1414 (pbp)
SSDB
Motif
Pfam: Transpeptidase PBP_dimer
Other DBs
NCBI-ProteinID: CAX67274
UniProt: D0R5B1
LinkDB
Position
complement(1335201..1337300)
AA seq 699 aa
MNYLKQSKGSNRNSTSTPLRMKIILGFILVLFLLLIGQLAYLQLFYGGRFQAEVQRTDQK
IVSNNVPRGVMYDSSGKVLVGNKANNAITYTKNSSITSSQIYKISNRLSQYITLDDEEPT
QRQLYDYYLANSKISEKETAKLPRSERYDSNGDALSSSQIYNNVLKRVEKQNIHFTKRQK
TAALIFNKISGAYTLSTIYIKNKDLTDREMALVGEHLSELPGVGIGTDWSRSYPNGKSIK
SIIGSVSSEKAGLPSDNLQYYLTQGYSRNDRVGTSYLEEKYEPLLKGTKSKSQVVTKSGD
SVEQTKTVYKGQSGASLILTMNAKYQQQVEDALKKQYAAAKAAGATQYSNGAYAVAMNPK
TGALLAIAGIDHNAKTNKDTDDALGVINKSFVMGSAVKGATVAGGLMNGVITPTNNVMPD
TPIYLPGSPIKKSVYPVGTFGSLDAPTALEVSSNIYMMQLALRWVNAKYTPHSFISMPSD
AFTKLRRNFAMFGLGQKTGVDLPGEVSGIQGRSYNSAGQLLTGSVLDLSYGNYDAYTPIQ
LVQYISTIANSGYRMRPYLVQSVGETNSQGNKVSILHNTKPQVQMRIPWTQNQLDVIHQG
MYRVVHGTNSWGTAHSLKNVKPSISGKTGTAQTFYYDEDNPGNPNAPEVINATFVGYAPS
KDPEIAVAVVFPGLDPDKEGSYTLQVAKAMVEDYFKLNK
NT seq 2100 nt   +upstreamnt  +downstreamnt
ttgaattatttaaaacagagtaaaggttcgaatagaaattccacttcgacgcccctaaga
atgaaaattattttgggcttcattttagttttatttttattattaattggtcaattagca
tacttacagcttttctacggtggacgttttcaagcagaggtacagcgaaccgaccaaaag
attgtatcaaataatgtaccacgtggtgtgatgtatgatagcagcggtaaagttttggta
ggtaataaagctaataacgcaattacttataccaaaaattctagcattacgtctagtcaa
atatataaaatttctaatcgcttaagtcaatatataacacttgatgatgaagaacctacc
caaagacagctttatgattattatttagctaacagtaaaatatcagaaaaggaaacagct
aagctgcctcgatctgaacgttatgacagtaatggggatgctttaagttcaagtcaaatc
tataacaatgtcttaaaacgtgttgaaaagcaaaatatccattttactaaacgtcaaaaa
acggctgctttaatttttaataagatttctggagcatacaccttatccactatctatatt
aagaataaagatctaactgatcgagagatggcattagttggagagcatttatctgaatta
ccaggtgtaggtattggaactgactggtcaagaagttatccaaatggaaaatccattaaa
agtatcattggttccgtttcttcagaaaaagctggtttaccaagtgataacttgcagtac
tacttaacacaaggttactcacgaaatgaccgtgtaggtacaagttacttagaagaaaag
tatgaaccgcttctgaaaggaactaagtctaagtcacaggtagttacgaagtccggagat
agtgttgaacaaactaagactgtctataaaggacaaagcggtgccagtttgattttgaca
atgaatgctaaatatcaacaacaagtagaagatgcactgaagaagcaatatgcggctgct
aaagctgcaggtgctacgcagtattctaatggtgcctatgcagtagcgatgaatccaaag
actggagcacttttagcgattgcaggtattgatcataatgcaaagactaataaagatact
gatgatgcgttaggtgtaattaataaatcctttgttatggggtctgcagtcaaaggtgca
actgttgcgggtggattaatgaatggtgttattacaccaactaataacgtaatgcccgat
acgccaatttacttgccaggttctccaattaagaaatctgtttacccagttggtacattt
ggtagtcttgatgccccaacagcccttgaagtatcaagtaatatttacatgatgcaattg
gctttaagatgggtaaatgctaaatatactccacatagttttatctcaatgccttcagat
gcatttactaaattgagacgtaattttgcaatgtttggtttggggcaaaaaactggtgta
gaccttcctggagaagtttcaggtattcaaggtcgctcatataactcagctggtcaattg
cttacaggttctgttcttgacttgtcttatggaaactatgatgcttatacaccaattcaa
ttagtacaatatatttcaactattgctaatagtggttatcgtatgcgcccatatttagtt
caatcagttggtgagactaattcgcaaggtaataaagtatcaattcttcataacactaag
ccacaagttcagatgcgtattccttggacgcagaatcaacttgatgttattcatcaaggg
atgtaccgcgttgttcatggtactaattcatggggaacagcacattcattaaagaatgtt
aagccttcgatttctggtaagactggtactgctcagactttttattatgatgaagataat
ccaggtaatccgaatgcgccagaagttattaatgctacttttgttggttatgccccatca
aaagatcctgaaattgctgtggctgtggtcttcccaggacttgacccagataaagaaggt
tcatataccttgcaagtggcaaaggcaatggttgaagactacttcaaacttaataaatag

DBGET integrated database retrieval system