KEGG   Lactobacillus johnsonii FI9785: FI9785_1712Help
Entry
FI9785_1712       CDS       T01120                                 

Definition
(GenBank) hypothetical protein predicted by Glimmer/Critica
  KO
K07009  lipid II isoglutaminyl synthase (glutamine-hydrolysing) [EC:6.3.5.13]
Organism
ljf  Lactobacillus johnsonii FI9785
Pathway
ljf00550  Peptidoglycan biosynthesis
ljf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ljf00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    FI9785_1712
Enzymes [BR:ljf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.13  lipid II isoglutaminyl synthase (glutamine-hydrolysing)
     FI9785_1712
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 GATase DJ-1_PfpI Peptidase_C26
Motif
Other DBs
NCBI-ProteinID: CAX67564
UniProt: D0R651
LinkDB All DBs
Position
1645141..1645824
Genome map
AA seq 227 aa AA seqDB search
MADKTIKIAYLYEDLMNTYGDSGDVKVIRYLLDKQGYQTEVDNISLDDSFDANDYDFLFF
GGGQDFEQTVVAKDLPRHKETIENYIKAGNPMLCICGGYQLMGDYYKTNSGITIKGLGIL
PLHTIFKADKRMIGDTRYMTEWGEVKAFENHSGQTYFDNTNMLHPFGEMIEGYGNNPQDK
VEGLRYKNFIGSYSHGPLLRNTNVANAIVKMILERHKERTANEVESV
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggcagataaaacaataaaaattgcatacttatacgaagatttaatgaatacttacgga
gattctggcgatgttaaagtaattcgttacctattggataagcaaggctatcaaactgaa
gttgataacatttcattagacgatagttttgatgctaatgactacgactttttattcttt
ggtggtggtcaagattttgaacaaactgttgtagctaaagatctgccacgtcataaggaa
acaattgaaaactatatcaaagccggtaatccaatgctttgcatctgtggtggttatcaa
ttgatgggagattattataaaaccaattctggcattaccatcaaaggattaggcatatta
cctctacatacaattttcaaggcagacaagcgaatgattggtgatacccgctatatgact
gaatggggcgaagtaaaagcttttgaaaatcattcaggacaaacttactttgacaatact
aatatgcttcatccctttggtgaaatgattgaaggttacggcaacaatcctcaagataag
gttgaaggtttacgctacaaaaactttattggatcatattcacacggaccgctacttcga
aacacaaatgtggcaaacgcaattgttaaaatgattttagaacgtcacaaggagcgtact
gctaatgaagttgaatccgtttag

DBGET integrated database retrieval system