KEGG   Lactobacillus johnsonii FI9785: FI9785_175Help
Entry
FI9785_175        CDS       T01120                                 

Gene name
ddlA
Definition
(GenBank) D-alanine-D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ljf  Lactobacillus johnsonii FI9785
Pathway
ljf00473  D-Alanine metabolism
ljf00550  Peptidoglycan biosynthesis
ljf01100  Metabolic pathways
ljf01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ljf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    FI9785_175 (ddlA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    FI9785_175 (ddlA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    FI9785_175 (ddlA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ljf01011]
    FI9785_175 (ddlA)
Enzymes [BR:ljf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     FI9785_175 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:ljf01011]
 Precursor biosynthesis
  Amino acid ligase
   FI9785_175 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 CPSase_L_D2 GARS_A ATPgrasp_ST RimK GARS_N
Motif
Other DBs
NCBI-ProteinID: CAX66061
UniProt: D0R232
LinkDB All DBs
Position
115934..117019
Genome map
AA seq 361 aa AA seqDB search
MTDKIKIGLIFGGNSSEYEVSIMSAHNIYEEIDTNKFDVYPMWITNDGYLADDADSRKVL
DNPKMEVANPHKVANISNIIELKDRPEIDVFFPIVHGNLGEDGCLQGLFRVLDKPFVGDD
VLAAAVTMDKEMTKILAQRAGVPVAKWIAVKRFEYNDPDNEKLDYEYVASQLGSDLFVKP
SNQGSSVGVSHVTNEKEYKVALAEAFKYDDKVLVEETVHGTEVETAVLGNDKPIVAGVGQ
IINAKDSFYTYENKYDDDSTSTLEIPAKLPEGIVETVRKNALKVFQATECSGLARIDSML
RSEDNEVVLTEVNALPGFTNISMYPKLFEEIGIPYTDLITKLIDYAMERYDHKKTLLHKH
D
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgactgacaaaattaagataggtttgatcttcggtggaaattcttcagaatatgaagtt
tctatcatgtctgcccacaacatttatgaagaaattgatactaataaatttgatgtttat
ccaatgtggattactaacgatggatacttagccgatgatgcagattctcgcaaagtatta
gataatcctaaaatggaagtggctaatcctcataaagtagctaatatttctaatattatt
gaattaaaagatcgtcctgaaattgacgtatttttcccaattgtacacggaaacttaggc
gaagatggttgtttacaaggactatttagagttttagataaaccatttgttggagacgat
gttttagcagcagctgtaacgatggataaggaaatgactaagatactcgctcaacgtgct
ggtgttcctgtagcaaaatggattgcagttaagcgttttgaatataacgatccagataac
gagaagttagactatgaatacgtagctagccaattgggttcagatttatttgttaaacca
tcaaaccaaggctcttcagttggtgtaagtcatgttactaacgaaaaagaatataaggtt
gctttagcggaagcctttaaatacgatgataaggttttagttgaagaaactgttcatggt
actgaagtagaaactgctgttttaggcaatgataaaccaatcgttgctggtgttggtcaa
attattaacgcaaaagattcattctatacctatgaaaataagtatgatgatgactcaaca
tcaactttagaaattcctgctaagcttcctgagggaattgttgaaacagttagaaagaat
gccttaaaggtgttccaagcaactgaatgtagcggcttggctcgtatcgattcgatgctt
cgtagtgaagataatgaagttgttctaacagaagtaaatgctcttcctggtttcactaat
attagtatgtatcctaagttatttgaagaaattggaattccatacactgacttaattact
aaattaattgattacgcaatggaacgctacgatcataagaagactttgttacataaacat
gattaa

DBGET integrated database retrieval system