KEGG   Lactobacillus johnsonii DPC 6026: LJP_0547Help
Entry
LJP_0547          CDS       T01960                                 

Definition
(GenBank) dipeptide/tripeptide permease
  KO
K03305  proton-dependent oligopeptide transporter, POT family
Organism
ljh  Lactobacillus johnsonii DPC 6026
Brite
KEGG Orthology (KO) [BR:ljh00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    LJP_0547
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTR2 MFS_1 DUF1129
Motif
Other DBs
NCBI-ProteinID: AEB92880
UniProt: F4AFP1
LinkDB All DBs
Position
612214..613707
Genome map
AA seq 497 aa AA seqDB search
MNNSTTEKTFFGQPRGLSTLFFTEMWERFSYYGMRAILLFYMYYAVERGGLGMNETTAAS
IMSIYGSLVYLSTVAGGWLADRIWGARSTVFFGGVLIMIGHIILALPMAELGLYISIAFI
VVGTGLLKPNVSDMVGGLYSLDDRRRDAGFSIFVFGINLGSALAPWLVPWASEGFGLNLF
GNHFNFHAGFSLAAVGMFFGLVQYVWGGRKYLSEDGMHPTDPIDPETRNKVLKRIGLGVL
ALAVVLGLMAAFGQLNIDNIITLITVVAIALPIYYFVLMLRSPKVTKEERSKVWAYIPLF
IAASIFWGIEESGSVVLALFAAQRTVLHIGGWHFTAANFQTLNPVFIMILTPFFVWLWDN
WKKQPSAAGKFAAGLVFAGLSYMWMALPGMLYGTNGRVSPFWLVGSWFIVEIAEMLISPI
GLSVTTRLAPKAFRSQMMSLWFLADATGQAINSQIVKYYSSKTEVAYFLAVGIVSVLFGV
VMFFFTKKIHNLMADAE
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgaataattcaacaacagagaagactttctttggacaacctcgtggtttgtccaccttg
ttcttcactgaaatgtgggagagatttagttactacggtatgcgtgctattttgctcttc
tacatgtattatgctgtagaacgtggcggactaggaatgaatgaaaccacggctgcttca
atcatgtctatctacggttcacttgtttatctttctacggtagctggtggatggttagca
gacagaatctggggagcacgcagtactgtcttctttggtggtgtcctcattatgattgga
cacattattttagccctaccaatggcagagttaggtttatatatttcaattgcatttatt
gtggtcggaacaggtttacttaagcctaatgtttctgatatggttggtggcttatactca
ttagatgatcgcagacgtgatgctggtttcagtatctttgtgtttggtattaacttagga
tcagcacttgctccatggttagttccttgggcaagtgaaggttttggccttaatttattt
gggaatcattttaacttccatgccggtttctctttggcggcagttggaatgttctttggc
ttagtacagtatgtttggggcggtagaaaatatctctctgaggatgggatgcacccaaca
gatccaatcgatccagaaactcgtaacaaagtcttaaagagaatcggtttaggagtttta
gctttagcagtagtattaggtttaatggctgcttttggtcaattaaatattgataatatc
attactttaattactgttgttgctattgccttaccaatttattactttgttttaatgctt
agaagccctaaagttacaaaagaggaacgctcaaaagtttgggcttacattcccttattt
attgcagcttctatcttctggggaattgaagaatccggttctgttgttttagctctattt
gctgcccaaagaacagtacttcacatcggaggatggcactttaccgcagctaacttccaa
actttgaacccagtatttattatgattttgactccattctttgtatggttatgggataac
tggaagaaacaaccaagtgctgctggtaaatttgctgctggtttggtctttgctggtctt
tcatatatgtggatggcccttccaggaatgctttatggaacaaacggacgagttagtccc
ttttggctagttggttcttggtttattgttgaaattgctgaaatgcttatttctccaatt
ggcttatctgtaactacacgtttagcaccaaaagctttccgttcacagatgatgagtctt
tggttcttggcagatgccactggtcaagctatcaactcccaaattgttaaatactactca
agtaaaactgaagtggcatacttcttagcagttgggattgttagtgtattgtttggtgta
gtgatgtttttctttactaagaaaattcataacttaatggcagatgctgaataa

DBGET integrated database retrieval system