KEGG   Lactobacillus johnsonii N6.2: T285_00910Help
Entry
T285_00910        CDS       T02941                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ljn  Lactobacillus johnsonii N6.2
Pathway
ljn00010  Glycolysis / Gluconeogenesis
ljn00260  Glycine, serine and threonine metabolism
ljn00680  Methane metabolism
ljn01100  Metabolic pathways
ljn01110  Biosynthesis of secondary metabolites
ljn01120  Microbial metabolism in diverse environments
ljn01130  Biosynthesis of antibiotics
ljn01200  Carbon metabolism
ljn01230  Biosynthesis of amino acids
Module
ljn_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ljn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    T285_00910 (gpmA)
  09102 Energy metabolism
   00680 Methane metabolism
    T285_00910 (gpmA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    T285_00910 (gpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ljn04131]
    T285_00910 (gpmA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ljn04147]
    T285_00910 (gpmA)
Enzymes [BR:ljn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     T285_00910 (gpmA)
Membrane trafficking [BR:ljn04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    T285_00910 (gpmA)
Exosome [BR:ljn04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   T285_00910 (gpmA)
  Exosomal proteins of melanoma cells
   T285_00910 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 TAF6_C
Motif
Other DBs
NCBI-ProteinID: AHA96669
UniProt: V5P355
LinkDB All DBs
Position
210473..211165
Genome map
AA seq 230 aa AA seqDB search
MSKLVLIRHGQSEWNLSNQFTGWVDVNLSEKGVEEAKKAGRLIKEHGLEFDQAYTSLLTR
AIKTLHYALEESDQLWIPETKTWRLNERHYGALQGLNKKDTAEKYGDEQVHIWRRSYDVL
PPAIDDDNEYSQAHDRRYANLDPHIVPKAENLHVTLDRVMPFWEDHIAPDLLDGKNVIIA
AHGNSLRALTKYIENISDDDIMDLEMKTGEPVVYTFDDKLDVVNKEKLDD
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaattagttttaattcgtcacggtcaaagtgaatggaacctttctaaccaattt
actggttgggttgatgtaaacctttcagaaaaaggtgttgaagaagctaagaaggctggt
cgtttaattaaggaacacggtcttgaatttgatcaagcttacacttcattattaactcgt
gctatcaagactttgcactacgcacttgaagaaagtgaccaactttggattcctgaaact
aagacttggagattaaacgaacgtcattacggtgctcttcaaggtttaaacaagaaggat
actgctgaaaagtacggtgacgaacaagttcacatttggcgtcgttcatacgatgttttg
ccaccagctattgatgacgataacgaatacagtcaagcacatgaccgtcgttacgcaaat
cttgatccacatatcgttcctaaggcagaaaacttacacgttactttagatcgtgtaatg
ccattctgggaagatcacattgctccagatttacttgacggcaagaacgttattattgct
gcacacggtaactcacttcgtgctttaactaagtacattgaaaacatctctgatgatgac
atcatggacttagaaatgaagactggtgaaccagttgtttacacatttgacgacaagtta
gatgttgttaacaaagaaaagcttgacgactaa

DBGET integrated database retrieval system