KEGG   Lactobacillus johnsonii NCC 533: LJ_0164Help
Entry
LJ_0164           CDS       T00158                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ljo  Lactobacillus johnsonii NCC 533
Pathway
ljo00010  Glycolysis / Gluconeogenesis
ljo00260  Glycine, serine and threonine metabolism
ljo00680  Methane metabolism
ljo01100  Metabolic pathways
ljo01110  Biosynthesis of secondary metabolites
ljo01120  Microbial metabolism in diverse environments
ljo01130  Biosynthesis of antibiotics
ljo01200  Carbon metabolism
ljo01230  Biosynthesis of amino acids
Module
ljo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ljo_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ljo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LJ_0164
  09102 Energy metabolism
   00680 Methane metabolism
    LJ_0164
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LJ_0164
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ljo04131]
    LJ_0164
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ljo04147]
    LJ_0164
Enzymes [BR:ljo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LJ_0164
Membrane trafficking [BR:ljo04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    LJ_0164
Exosome [BR:ljo04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LJ_0164
  Exosomal proteins of melanoma cells
   LJ_0164
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 TAF6_C
Motif
Other DBs
NCBI-ProteinID: AAS08146
UniProt: Q74LL9
LinkDB All DBs
Position
196136..196828
Genome map
AA seq 230 aa AA seqDB search
MSKLVLIRHGQSEWNLSNQFTGWVDVNLSEKGVEEAKKAGRLIKEHGLEFDQAYTSLLTR
AIKTLHYALEESDQLWIPETKTWRLNERHYGALQGLNKKDTAEKYGDEQVHIWRRSYDVL
PPAIDDDNEYSQAHDRRYANLDPHIVPKAENLHVTLDRVMPFWEDHIAPDLLDGKNVIIA
AHGNSLRALTKYIENISDDDIMDLEMKTGEPVVYTFDDKLDVVNKEKLDD
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaattagttttaattcgtcacggtcaaagtgaatggaacctttctaaccaattt
actggttgggttgatgtaaacctttcagaaaaaggtgttgaagaagctaagaaggctggt
cgtttaattaaggaacacggtcttgaatttgatcaagcttacacttcattattaactcgt
gctatcaagactttgcactacgcacttgaagaaagtgaccaactttggattcctgaaact
aagacttggagattaaacgaacgtcattacggtgctcttcaaggtttaaacaagaaggat
actgctgaaaagtacggtgacgaacaagttcacatttggcgtcgttcatacgatgttttg
ccaccagctattgatgacgataacgaatacagtcaagcacatgaccgtcgttacgcaaat
cttgatccacatatcgttcctaaggcagaaaacttacacgttactttagatcgtgtaatg
ccattctgggaagatcacattgctccagatttacttgacggcaagaacgttattattgct
gcacacggtaactcacttcgtgctttaactaagtacattgaaaacatctctgatgatgac
atcatggacttagaaatgaagactggtgaaccagttgtttacacatttgacgacaagtta
gatgttgttaacaaagaaaagcttgacgactaa

DBGET integrated database retrieval system